[ / / / / / / / / / / / / / ] [ dir / random / animus / ausneets / cyber / feet / htg / lit / mental / sapphic ]

/qresearch/ - Q Research

Research and discussion about Q's crumbs
Name
Email
Subject
Comment *
File
Password (Randomized for file and post deletion; you may also set your own.)
Archive
* = required field[▶ Show post options & limits]
Confused? See the FAQ.
Embed
(replaces files and can be used instead)
Voice recorder Show voice recorder

(the Stop button will be clickable 5 seconds after you press Record)
Options

Allowed file types:jpg, jpeg, gif, png, webm, mp4, pdf
Max filesize is 16 MB.
Max image dimensions are 15000 x 15000.
You may upload 5 per post.


Welcome Page | Index | Archive | Voat Subverse | Poal Sub | Q Posts | Notables | Q Proofs
Q's Board: /projectdcomms/ | Legacy Boards: /CBTS/ /TheStorm/ /GreatAwakening/ | Politics News & Debate: /pnd/

File: e110031b11d5d8e⋯.png (45.85 KB, 250x140, 25:14, b583bfbcb1d9f492d74d71052d….png)

8d25df  No.12310764[Last 50 Posts]

Welcome To Q Research General

We are researchers who deal in open-source information, reasoned argument, and dank memes. We do battle in the sphere of ideas and ideas only. We neither need nor condone the use of force in our work here.

"We hold these truths to be self-evident: that all men are created equal; that they are endowed by their Creator with certain unalienable rights; that among these are life, liberty, and the pursuit of happiness."

VINCIT OMNIA VERITAS

SEMPER FIDELIS

WWG1WGA

Q's Private Board

>>>/projectdcomms/ & Q's Trip-code: Q !!Hs1Jq13jV6

Q's Latest Posts

Tuesday 12.08.2020

>>11953143 ————————————–——– We're Not Gonna Take It (CAP: >>11953295)

Onion Link

Access through Tor http://jthnx5wyvjvzsxtu.onion/qresearch/catalog.html

New here? Q Proofs & Welcome

Welcome to Q Research (README FIRST, THEN PROCEED TO LURK) https://8kun.top/qresearch/welcome.html

100+ Q Proof Graphics qproofs.com

8kun FAQs https://8kun.top/faq.html

Find Q drops here

Main QAnon.pub - qresear.ch/q-posts - QAlerts.pub - operationQ.pub - QPosts.online - qanon.news/Q - 8kun.top/qresearch/qposts.html

Backups qntmpkts.keybase.pub - QAlerts.app - QAlerts.net - douknowq.com/134295/Q-Anon-Pub.htm - we-go-all.net/q.html -

Dealing with Clowns & Shills

New? Use logic and reason when evaluating posts, look beyond the content of the post(s) and evaluate intent.

>>2322789 How To Quickly Spot A Clown

____________________________
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

8d25df  No.12310769

Global Announcements

>>12263192 Anon uploaded the Video about Election Fraud that Youtube deleted from POTUS Youtube account - SHARE SHARE SHARE

>>11509939 AN OFF BREAD RESOURCE FOR DOMINION/SMARTMATIC

>>12236190 Know the gun laws of Washington DC if you go there on the 6th

Report Election/Voter Fraud Directly to Sidney Powell https://defendingtherepublic.org

Support Lin Wood https://fightback.law/

Support Sidney Powell https://defendingtherepublic.org/

CM Research "Executive Directive 51" https://mobile.twitter.com/CodeMonkeyZ/status/1337927415465533440

CM YOUTUBE ARCHIVE https://rumble.com/vbij1v-dominion-voter-fraud-drama-bombshell-video-by-ron-codemonkey.html

Notables Are Not Endorsements

#15714

>>12310096, >>12310239 Patrick Byrne tweets

>>12310138 Over 432,000 Votes Removed From Trump in Pennsylvania

>>12310163, >>12310332 DJT tweet

>>12310175 Mexico offers political asylum to Julian Assange

>>12310227 Here's how Merkel and von der Leyen urged the health minister to cede the vaccine mandate to the EU

>>12310295, >>12310390 "intel LIN gence" Q #4

>>12310320 Lin Wood fire side chat

>>12310277, >>12310286, >>12310293, >>12310340, >>12310436 Anon theory: All [3] movies playing simultaneously?

>>12310401 Lin Wood tweets

>>12310411 Ted Cruz Discusses January 6th Electoral Certification

>>12310484 Nicola Sturgeon announces lockdown in Scotland from midnight

>>12310523 The dictatorship of the Chinese Communist Party is allied to the global deep state

>>12310575, >>12310639, >>12310712 Raffensperger BEGGED For 100 Chinese To Vote For Him By Mail in 2015, Won By 159 Votes

>>12310584 United Kingdom is raising the nationwide #COVID19 alert level to 5

>>12310636 Queen's cousin Lady Mary Colman dies aged 88

>>12310646 President Donald Trump Rally LIVE in Dalton, GA 1/4/21 (3h)

>>12310693 Anti Lockdown protesters flooded Nuremberg last night

>>12310704 Washington DC @MayorBowser is requesting support by the National Guard for January 6th

>>12310715 New Year, New Sailors!

>>12310475, >>12310709 pf

>>12310756 #15714

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

8d25df  No.12310772

#15713

>>12309283 James O'Keefe says he had UNDERCOVER people in GA. for months

>>12309321 C Herridge - British judge rejects US request to extradite WikiLeaks founder Julian Assange to face espionage charges, saying it would be "oppressive" because of his mental state.

>>12309327 KANSAS IS SAVAGE (video)

>>12309328 , >>12309959 Twitter Account for https://twitter.com/MikayesFiona is now suspended, She was pushing for everyone to call and email Congress re: election fraud

>>12309342 Grenell, after going off DNI, was main person involved into making peace between Serbia and Kosovo.

>>12309351 The prayer to open the 117th Congress ended with "amen and a-women." (video)

>>12309409 FF in Queens? - Reports of 'vehicle with explosives'

>>12309461 Lin Wood - The number of missing children worldwide & in the USA is staggering (Seems consistent with what Q has been dropping.)

>>12309477 Anon opines that with Lin Wood disclosures patriots are in control and about to cross the Rubicon

>>12309564 Ron supports Lin Wood. Trump retweets Rons posts lately. If Lin is crazy then Ron is also? Then Trump is also? Then aprox 75mil voters are also?

>>12309594 @JamesOKeefeIII 11h Veritas has had an team of undercover agents in Georgia for months.

>>12309653 Spanish King Juan Carlos, 82, looking very frail

>>12309668 Boris Johnson to address UK on new China Virus lockdowns

>>12309712 Bannon War Room Live (video link)

>>12309718 Americans Own 40 Percent of World's Guns

>>12309737 DJT - How can you certify an election when the numbers being certified are verifiably WRONG

>>12309777 Patriot Jovan Pulitzer’s Team Is Being Shot At! – After They Were Given Directive to Identify Fraudulent Ballots in Fulton County

>>12309807 O'Keefe - Dem GA Sen Candidate Warnock's staff admit candidate's bias against police.

>>12309813 DJT - You will see the real numbers tonight during my speech, but especially on JANUARY 6th

>>12309825 President / Vice President 'contingent election' explained

>>12309841 Michelle Malkin - Dems are mentally and womentally deranged (Prayer for Congress ends with 'amen' and 'awomen'

>>12309863 Israel completes Iron Dome delivery to US Army

>>12309881 , >>12309889 Detention Camps for people exposed to China Virus?

>>12309885 Jovian Pulitzer - My team has been provided with evidence of mail in ballots with the votes already filled in BY MACHINE

>>12309886 NEW DJT “We’ve seen in the last few months, unprecedented amounts of Voter Fraud.” @SenTedCruz True!

>>12309896 Look at this Q drop. Child sacrifice (Q Post 703)

>>12309926 DJT - We are not acting to thwart the Democratic process. We are acting to protect it - Sen Ron Johnson

>>12309937 Kevin McCarthy Announces Support for Challenge to Electoral College

>>12309972 Patrick Byrne thread - starts with - ' Read and retweet as though your life depends on it, which it does.'

>>12309977 Rep. Liz Cheney (R-WY) and former House Speaker Paul Ryan (R-WI) are attacking Republican lawmakers who plan to challenge the electoral college

>>12310005 #15713

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

8d25df  No.12310774

#15712

>>12308469 “ President Donald Trump is in a “really good position” for Wednesday’s challenge in Congress, according to former Director of National Intelligence Ric Grenell.

>>12308482 If you're going to the @MilionMagaMarch BRING WALKIE TALKIES! Your phone WILL NOT WORK!

>>12308488 Lin Wood's Jan 4th Tweet Storm consolidated into a video

>>12308576 Trump 'just plain wrong' on fraud claims: Georgia Secretary of State Raffensberger defends his corruption

>>12308590 Bail Decision on Wednesday! Julian Assange Hearing - Outside the Old Bailey Live

>>12308592 Chinese billionaire Jack Ma is missing after criticizing the Chinese government. Wow. This would be like the U.S. government kidnapping Jeff Bezos or Mark Zuckerberg to teach them a lesson.

>>12308601 Precipice comms in the Mark Levin video POTUS tweeted last night. "We're standing at the precipice and we're looking into the abyss."

>>12308605 Julian Assange: British judge rejects US's request to extradite WikiLeaks founder

>>12308608 5 Florida Judges Reprimanded in $500 Million Child Welfare Agency Conflict

>>12308609 Reducing our Food Supply – Is it Intentional?

>>12308612 Kamala Harris sworn in as US Senator on Sunday

>>12308617 Anon dig on Pompeo's use of " China's Pangolin's Nose"

>>12308626 Johnson & Johnson's single-dose vaccine next to seek emergency use authorization

>>12308691 Joseph J Flynn - retweet of Jovan Pulitzer - one of his team members took 5 shots through the windows on a drive by

>>12308693 Disabling the camera and microphone in smart tvs?

>>12308721 BBC News pushing this 'find me more votes' story to discredit POTUS

>>12308722 400,000 kids missing in US every year. 350,000 US people reported dead from coronavirus this year. Yet MSN never seems to say a word about the children.

>>12308734 Judge blocks Assange extradition, saying US Prison System can't protect him

>>12308740 Jon Voight: America (video)

>>12308749 Seven days in January? Former Def Secretaries warn Trump over Election Fight

>>12308797 PANIC DC says no guns allowed during MAGA election protest

>>12308813 Iran 'resumes enriching uranium to 20% purity at Fordo facility'

>>12308815 Assange case adjourned until Wednesday the 6th of January. Assange remains behind bars

>>12308834 Tom Fitton - URGENT! Call state legislators in PA, GA, MI, WI, NV, and AZ to share what you think about appointing clean slate of electors for @realDonaldTrump

>>12308839 CM - Pray for the families of the missing children. Pray for Lin Wood for standing as a beacon of light

>>12308847 Additional COVID-19 restrictions imposed last month in Pennsylvania have expired

>>12308856 Mexican Coyotes Abandon 48 Migrants in Winter Storm near Border, 2 Dead

>>12308890 , >>12308944 Leon Panetta’s Communist Friend, and the Chinese Spy - Obama’s CIA Director Linked to Spies Through Communist Party Figure

>>12308894 Chicago holiday weekend gun violence leaves 30 shot, 5 killed across city

>>12308898 White House Planning to Refer Brad Raffensperger to Secret Service for Investigation Under the Espionage Act

>>12308911 CM tweet referring to the danger of data miners challenging the Election Fraud

>>12308982 Tom Cotton Statement on Joint Session of Congress (Cotton ok with massive election fraud)

>>12309042 Moderna/Pfizer vaccines are not a vaccine, they are mRNA gene therapies - Genetic Scientist Alexandra Caude (Video)

>>12309052 Masks conceal the identity of children making it easier to transport them in human trafficking/smuggling

>>12309050 OAN report - Space Aliens have visited Earth (Video)

>>12309054 2nd Marine Division - Learn to fight in the cold

>>12309078 CIA assets killed in China soon after Leon Panetta took office

>>12309121 TRUMP DROPS A BOMB DURING PHONE CALL! Tells Raffensperger “Vote Scammer and Hustler” Ruby Freeman Was Behind 18,000 FRAUDULENT VOTES

>>12309134 OAN Report from 9am EST - Trump Rally / VP Pence Rally both in GA 12pmEST POTUS files suit against GA SOS More evidence of vote/election fraud (Video)

>>12309146 O'Keefe - Warnock (GA Sen Dem Candidate) staff admit Warnock's bias against Police

>>12309191 Rep. Elise Stefanik will object to certifying Electoral College results

>>12309211 #15712

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

8d25df  No.12310777

Previously Collected Notables

>>12308368 #15711

>>12306038 #15708, >>12306817 #15709, >>12307603 #15710

>>12303525 #15705, >>12304263 #15706, >>12305316 #15707

>>12301149 #15702, >>12301952 #15703, >>12302750 #15704

>>12298260 #15699, >>12299427 #15700, >>12300364 #15701

>>12295924 #15696, >>12296674 #15697, >>12297537 #15698

>>12293350 #15693, >>12294316 #15694, >>12303022 #15695

>>12290935 #15690, >>12291934 #15691, >>12292752 #15692

>>12289414 #15688, >>12290161 #15689, >>12290935 #15690

>>12287103 #15685, >>12287869 #15686, >>12288625 #15687

>>12284759 #15682, >>12285578 #15683, >>12286420 #15684

>>12282195 #15679, >>12282927 #15680, >>12283924 #15681

Notables Aggregators: https://wearethene.ws & https://qnotables.com

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

8d25df  No.12310781

QRMemes: Social Media Warfare Armory

>>>/qrmemes/ ————————————–——– New One-stop Meme Board, organized by topic

archive.is/hogSX ————————————–——– Digital Camo Thread Archive

Other Dedicated Research Threads

>>9901078 ————————————–——– Questions & Practice Thread

>>11039643 ————————————–——– Clockwork Qrange #11

>>>/qrb/13005 ————————————–——– Planefagging 101 Q&A

>>>/qrb/42185 ————————————–——– Boatfagging Q&A

International Q Research Threads

>>12076528 ————————————–——– Australia #12

>>11995326 ————————————–——– Balkan #2

>>11581748 ————————————–——– Brazil #1

>>12053898 ————————————–——– Canada #11

>>11250635 ————————————–——– China #1

>>8331823 ————————————–——– France #2

>>12145439 ————————————–——– Germany #73

>>10838222 ————————————–——– Italia #1

>>11487786 ————————————–——– Israel/Zionism #1

>>12219245 ————————————–——– Japan #1

>>9133907 ————————————–——– Mexico #1

>>10497699 ————————————–——– Nederland #5

>>10524823 ————————————–——– New Zealand #5

>>5290557 ————————————–——– Nordic #1

>>11937308 ————————————–——– Scotland #2

>>11550704 ————————————–——– South Africa #2

>>12196203 ————————————–——– UK #28

>>11306246 ————————————–——– Vatican #2

Q Proofs

>>6156082 ————————————–——– Q Proofs Threads, Proofs of Q's Validity

QProofs.com ————————————–——– Website dedicated to Q Proofs

Book of Q Proofs ————————————–——– https://mega.nz/#F!afISyCoY!6N1lY_fcYFOz4OQpT82p2w

Q Happenings Calendar

Submit an Event ————————————–——– https://teamup.com/ks8x4ixptej432xt2a

Main Calendar URL ————————————–——– https://dark-to-light.org/calendar/

Resignations

Website ————————————–——– https://www.resignation.info

Sealed Indictments

Sealed Indictment Master: https://docs.google.com/spreadsheets/d/1kVQwX9l9HJ5F76x05ic_YnU_Z5yiVS96LbzAOP66EzA/edit#gid=1525422677

Sealed Indictment Master Files Backup: https://drive.google.com/open?id=1iBS4WgngH8u8-wAqhehRIWCVBQKD8-5Y

Searchable Indictment Map w/Dockets, Links & More: https://bad-boys.us/

Board Admin & Discussion Threads

>>11716920 ————————————–——– META (for board admin queries)

>>11728868 ————————————–——– Q Research General Dough/Kitchen Meta

Letters of Gratitude

>>1215912 ————————————–——– (Q posted in #1025)

Q Graphics / The MAP - All In GMT

>>11187218 ————————————–——– #001 and scroll down for all continuing in numerical order

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

8d25df  No.12310783

QPosts Archives

* QMap & Mirrors PDF:

MEGA: https://mega.nz/#!pjpS1aBI!LwepOu-CyC4UlLj2dXqkxiH49D813WetrOF0OCuIg1Y

MEDIAFIRE: https://www.mediafire.com/file/xszgdtiow4hups0/Q_Anon_-_The_Storm_-_X.VII.pdf/file

SCRIBD: https://www.scribd.com/document/419874308/Q-Anon-The-Storm-X-VII?secret_password=55SQ1tCYhuNR8ESzm50u

* QPosts Archive, Players in the Game/ Analytics on Q posts & More: qmap.pub

* QPosts Archive, Searchable, interactive with user-explanations: qanon.pub qanon.app (Backup: qntmpkts.keybase.pub)

* QPosts Archive + RSS, Searchable, Analytics, Offsite Bread Archive: qanon.news

* Spreadsheet QPosts Q&A and all images backup: https://docs.google.com/spreadsheets/d/1Efm2AcuMJ7whuuB6T7ouOIwrE_9S-1vDJLAXIVPZU2g

QPosts Archives in Other Formats

* Q Raw Text Dumps: q-clock.com/q_raw.txt

* Expanded Q Text Drops: pastebin.com/dfWVpBbY

* Spreadsheet Timestamps/Deltas: docs.google.com/spreadsheets/d/1OqTR0hPipmL9NE4u_JAzBiWXov3YYOIZIw6nPe3t4wo/

* Memo & OIG Report Links: 8kun.top/qresearch/res/426641.html#427188

* Original, full-size images Q has posted: https://postimg.cc/gallery/29wdmgyze/

QResearch Search Engine

* Search all posts from QResearch: https://qresear.ch/

Tweet Tools

* Deleted Trump Tweets: https://factba.se/topic/deleted-tweets

* POTUS' Tweet Archive: trumptwitterarchive.com

* Twitter Video Downloader: http://twittervideodownloader.com/

Other Tools

* Searchable Commercial Aviation Incident List: http://avherald.com

* Searchable Hussein WH visitor list: https://archive.org/details/WHvisitorlogs_2010-16_date

* Qcode Guide to Abbreviations: pastebin.com/UhK5tkgb

* Q Happenings Calendar 2018: https://mega.nz/#F!KPQiBJiY!dK3XRe4RYoXgWq_85u4-yg

* Legal News: www.justice.gov/usao/pressreleases

* Stock Movement Scraper: http://qest.us (for seeing LARGE movements of $)

* Updated All Google Search Operators: https://ahrefs.com/blog/google-advanced-search-operators/

* Module Retired - Federal Procurement Data System: https://www.fpds.gov/fpdsng_cms/index.php/en/

* Federal Judicial Court dataset from 93 Federal Districts - Searchable db: https://bad-boys.us/

* Catalog of US Government Publications: https://catalog.gpo.gov/F?RN=306384688

* Webpage Archiver: http://archive.md/

* Baker Tools v0.7.3: https://pastebin.com/EDmx2iEr

* Check Criminal Cases: https://www.justice.gov/usao/find-your-united-states-attorney

* Get your Q clocks anytime (0 - 59 min past posts): https://q-clock.com

Bread Archives (sites)

Board Archive - The main /research/ board archive: https://8kun.top/qresearch/archive/index.html

Offsite Archive - qanon.news/archives

Bread Archives (downloads)

MasterArchivist qarchives.gq | masterarchivist.github.io/qarchives/

Supplement to MA main spreadsheet, 2nd tab (labeled)

Germanarchiveanon https://mega.nz/folder/LPZxEIYJ#N5JwCNoxOxOtAoErKdUgvw

Missing Catalog Bredz 10964-11007 https://pastebin.com/xT0PWKMf

https://docs.google.com/spreadsheets/d/1M2AzhZKh2PjL7L7GVPN42Em0hZXKWMdhGnj59ZQ3YcQ/edit#gid=0

Learn To Bake!

Quick Pic Bake Instructions & simple instructions: >>>/qrb/10809, https://pastebin.com/aY5LyDPY

Baker templates for formatting crumbs plus links: https://pastebin.com/36a1EXpR

Iwo Jima videos: https://youtu.be/5zezIBBxjEs, https://www.youtube.com/watch?v=MLCupx1UExg

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

8d25df  No.12310788

File: 36bed077cc8c19a⋯.jpg (68.76 KB, 720x720, 1:1, 36bed077cc8c19a28feea61d22….jpg)

Dough

https://controlc.com/68bfa89c

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

fd817c  No.12310816

File: a295d1624ba88f8⋯.png (151.38 KB, 355x217, 355:217, a295d1624ba88f81d94480838d….png)

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

127ae9  No.12310834

File: a2732ac400abe23⋯.jpeg (1.3 MB, 3024x4032, 3:4, E78ECD5A_EAEC_439D_8439_4….jpeg)

File: 75d08040a8d4e11⋯.jpeg (100.88 KB, 599x710, 599:710, B895C12F_2837_4C2E_9B2E_8….jpeg)

File: bbd82d15cb717b3⋯.jpeg (1.32 MB, 4003x3247, 4003:3247, 51D846C7_852C_4AD2_9D37_3….jpeg)

File: 9f21325b1700d01⋯.jpeg (185.79 KB, 2041x462, 2041:462, 8BC30E09_7C7A_493A_A47D_1….jpeg)

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

fd817c  No.12310838

File: 156995a5695cebd⋯.png (122.45 KB, 225x225, 1:1, ClipboardImage.png)

Right After Is Ra El

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

c94518  No.12310840

Jeremiah 1:19

They will fight against you but will not overcome you, for I am with you and will rescue you,” declares the Lord.

Jeremiah 29:11

For I know the plans I have for you,” declares the Lord, “plans to prosper you and not to harm you, plans to give you hope and a future.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

92e640  No.12310848

File: dc688a185c11704⋯.png (464.61 KB, 800x450, 16:9, ClipboardImage.png)

>>12293544 /pb

>>>12289550 “U.S. officials are reportedly privately worried Russia stole blueprints for U.S. blackout restoration

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

dcb9e0  No.12310860

File: 81b49f4ff9c9323⋯.mp3 (157.31 KB, 2021_01_04T16_50_35.mp3)

-*-

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

130660  No.12310863

File: d8b78b5bf896bd1⋯.png (607.7 KB, 613x858, 613:858, CD509101_953D_4685_BF43_E0….png)

Why are they trying to call in the National Guard on protesters for the 5th and 6th? Do they think the protesters will try to storm the reichstag and hang all the traitors or something?? Lmao wtf!

These people are just plain silly!

Silly I tell ya!

https://twitter.com/disclosetv/status/1346131667560378371

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

dcb9e0  No.12310870

File: ea495decd1c5c5b⋯.mp3 (157.31 KB, 2021_01_04T16_51_38.mp3)

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

6050a9  No.12310872

Lin wood hasn't said anything we haven't heard before. Not sure what the big revelation is here.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

6c4a2e  No.12310873

File: 2e43e92ed6f82a7⋯.png (54.18 KB, 969x682, 969:682, 2e43e92ed6f82a7a30b0f6b719….png)

Q

Storm time?

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

dcb9e0  No.12310877

File: 98c612ab8343b78⋯.mp3 (157.31 KB, 2021_01_04T16_52_09.mp3)

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

327eab  No.12310881

File: a9cd52335aca077⋯.jpg (116.41 KB, 843x1116, 281:372, download_3_.jpg)

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

666a80  No.12310882

>>12310788

TYB

so how many plainclothes LEO, mil, etc. 3-letters in D.C. Wednesday?

don't be stupid, anons.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

385563  No.12310883

File: d917de3b93dbce2⋯.png (355.02 KB, 704x914, 352:457, adolfhh.png)

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

fd75bf  No.12310884

>>12310838

https://en.wikipedia.org/wiki/Elagabalus

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

65da4c  No.12310885

Russia now probing case of helicopter downed by Azerbaijan as murder -Interfax

MOSCOW (Reuters) - Russian military investigators are now treating the Nov. 9 downing of a helicopter over Armenia as "wilful murder", a more serious charge than the previous "death through negligence", Interfax news agency reported on Monday, citing a source.

A Russian Mi-24 helicopter was shot down over Armenia near the border with a region belonging to Azerbaijan, killing two crew members and injuring another, just few hours before a Moscow-brokered peace deal over Nagorno-Karabakh was reached.

Heavy fighting between Azerbaijan, which has the political backing of Turkey, and ethnic Armenian forces over the mountainous region had been raging for six weeks at the time of the incident.

Azerbaijan's Foreign Ministry said Azeri forces shot down the helicopter by accident, expressing apologies to Moscow and a readiness to pay compensation.

Interfax said on Monday, citing the source, that a case had initially been opened into a potential infringement of flying regulations that had resulted in deaths through negligence.

The reported switch to a murder charge, which could lead to a sentence of life imprisonment for those held responsible, may complicate relations between Moscow and Azerbaijan.

The conflict has tested Moscow's influence in the South Caucasus, a swath of the former Soviet Union it views as vital to defending its own southern flank.

https://www.yahoo.com/news/russia-now-probing-case-helicopter-142001553.html

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

ef5c37  No.12310886

Extraordinary warning to Trump by 10 former Pentagon chiefs

“The time for questioning the results has passed,” they wrote.

WASHINGTON — In an extraordinary rebuke of President Donald Trump, all 10 living former secretaries of defense are cautioning against any move to involve the military in pursuing claims of election fraud, arguing that it would take the country into “dangerous, unlawful and unconstitutional territory.”

https://www.nbcnews.com/politics/white-house/extraordinary-warning-trump-10-former-pentagon-chiefs-n1252704

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

dcb9e0  No.12310887

File: 4c4ebad470b6fd5⋯.mp3 (157.31 KB, 2021_01_04T16_53_35.mp3)

-*–

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

3bb08e  No.12310888

Qua non needs a spine today.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

870559  No.12310889

File: 78902264aaf8813⋯.jpeg (348.85 KB, 732x449, 732:449, 9E2AAD3E_E26B_40E1_A644_4….jpeg)

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

5a98bb  No.12310890

File: 290035b7c2b2e56⋯.png (291.83 KB, 634x706, 317:353, hoax_christchurch.png)

>>12310886

>former Pentagon chiefs

one of those words is important.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

07d1f1  No.12310891

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

ef5c37  No.12310893

https://www.theepochtimes.com/exclusive-over-432000-votes-removed-from-trump-in-pennsylvania-data-scientists-say_3642202.html

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

dcb9e0  No.12310894

File: f4fc19f621ec8c0⋯.mp3 (157.31 KB, 2021_01_04T16_54_06.mp3)

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

2ec61d  No.12310895

File: 264e9f9f7cbb8fb⋯.jpg (220.69 KB, 2048x950, 1024:475, 264e9f9f7cbb8fbb5d9074a5cc….jpg)

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

aee2a0  No.12310896

>>12309477

>>12309477 PB

>In regards to Lin Wood, let's analyze a few points:

>A. He is stating that Chief Justice Roberts adopted his children through Epstein.

>B. Chief Justice Roberts adopted his children for a pedophilia sacrifice.

>C. Lin directly asks Roberts if he is a member of a cabal that requires minor children as an initiation fee.

>D. He claims that Roberts discussed Scalia's death before it occurred.

>E. It is stated that with absolute certainly that Epstein is still alive and cooperating.

>His claims acknowledge that there is a cabal that requires pedophile acts in order to be apart of their group. The Chief Justice of the Supreme Court is a part of these cabal and sacrifices his own adoptive children to be apart of this group. This group is so powerful that they are able to kill a supreme court justice. With only reviewing what Lin Wood is stating, he would be murdered just for even simply alluding to all of this. He basically just signed his death warrant. I don’t believe that Lin has a death wish, he knows what he just exposed puts a giant target on his back. The only rational explanation for his statements is that this cabal is no longer a threat, and the patriots are in control, and are about to Cross the Rubicon.

You cannot assume Patriots are in control by this. Never assume that. So many have died trying to uncover these truths and just know that the only protection he has were the keys of encryption and KAPPY had those keys, ASSANGE, etc and they are not protected! The tentacles are thousands and there is no way that protection is guaranteed.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

518715  No.12310897

>>12310872

First time this is pronounced by someone with Nationwide name recognition on social media and hasn't been censored.

So either it is true, or disinformation the cabal wants spread around.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

b0b660  No.12310898

File: 63fb6c1dfb5febe⋯.png (4.35 MB, 1334x750, 667:375, A7CA0B94_736E_4591_933E_64….png)

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

f56d94  No.12310899

>>12310872

The Precipice doesn't allow for much to cheer about so many have to take solace in whatever they can.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

3bb08e  No.12310901

>>12310863

guard comp'd? of course, they're all masons, right? doctors, local guys?

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

e34828  No.12310902

File: 98dbab6a15922f0⋯.png (358.32 KB, 750x498, 125:83, trump_eagle_hair_dont_trea….png)

>>12310788

Chekt and TYB

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

dcb9e0  No.12310903

File: 391a512f3fea506⋯.mp3 (157.31 KB, 2021_01_04T16_54_37.mp3)

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

f5d86c  No.12310904

>>12310834

>>12310377 lb

Here's my thought regarding this

"gun to rape/gun to kill" tweet

Lin posted last night/early this morning.

Up to this point, the whole "blackmail"

thing seemed like it was a

CAUGHT IN THE ACT type of blackmail.

So, all this pedocrap going on were with

total scumbags who were doing it

just because they could and someone

had a hidden cam then showed

'em the GOTCHA tape and that's it.

Handled and controlled.

Now, with Lin's "revelation", it comes

across as

COERCED IN THE ACT blackmail where

their defenders could say it was

AGAINST THEIR WILL/UNDER DURESS

type of crap and a segment of the

un-awakened genpop will have their

empathy switch FLIPPED ON and the

FEEL SORRY FOR THEM factor will

kick-in for those "being" blackmailed into

it.

Which, in their eyes will now look like VICTIMS!

Victims my ass.

So, there better be distinctions and

CLEAR LINES DRAWN and

WHOLE PICTURES PAINTED of

who's who and what's what!

Don't tell me the Lolita Island hoppers

were there because they were

FORCED TO BE THERE at gunpoint.

Same with the PODESTA PIZZAGATE

PARTY PEDOS.

Fuck dat shit. Ain't no way, motherfucker!

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

4470a2  No.12310905

JOHN CARDILLO IS UNHINGED BECAUSE OF LIN WOOD

The new narrative is, "if you call out lunacy, you're jealous of the lunatic."

https://twitter.com/johncardillo/status/1346134634598440965

And his reply to someone

Lin Wood is not uncovering anything. And the numbers on the missing kids is wrong. Most are runaways who are quickly recovered.

https://twitter.com/johncardillo/status/1346135909939478530

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

89d978  No.12310906

>>12310863

Democrats call in the NG on Trump supporters but let Antifa tear down statues and burn churches down wtf kind of sense does that make??

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

a1b27b  No.12310908

File: 66fabe24395c91c⋯.png (131.46 KB, 932x753, 932:753, Q_4881.png)

Q#4881

Q !!Hs1Jq13jV6 10/17/2020 12:36:26

https://twitter.com/stinchfield1776/status/1317450311192223746

There is 'Q'. 1

There are 'Anons'. 2

There is no 'Qanon'. 3

Media labeling as 'Qanon' is a method [deliberate] to combine [attach] 'Q' to comments _theories _suggestions _statements [and ACTIONS] made by 2.

WHAT HAPPENS WHEN YOU CANNOT ATTACK THE INFORMATION [primary source 1]?

DO YOU ATTACK [& TYPECAST] THROUGH USE OF OTHERS?

Not all 'Anons' are authentic [injected].

You are correct, CJ.

Retweet @ 17:17 had meaning. [mathematical probability _17:17 [day after]?]

Do you believe it was a coincidence surgical removal of You Tube accounts occurred same day as 'Hunter' drop?

Welcome to the Digital Battlefield.

Q

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

a29ff6  No.12310909

File: 0d11c2e4c6e3b8c⋯.png (972.58 KB, 985x653, 985:653, dudes.png)

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

385563  No.12310910

>>12310872

exposure

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

cb893e  No.12310911

File: 8848cb8e43d85c9⋯.jpeg (1.42 MB, 1036x1306, 518:653, AB341758_358F_4BC5_9B82_E….jpeg)

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

65da4c  No.12310912

>>12310886

They are putting out Fear of the MIL ahead of what's coming.

That is Mutiny.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

edaf99  No.12310913

File: 8d446f823f4c3c1⋯.png (1.24 MB, 1090x669, 1090:669, Screenshot_2021_01_04_Near….png)

>>12310863

Still trying to convince the world it was Trump supporters who were violent on those days…scare tactic also to deter supporters from showing up.

Trump supporters marched from Freedom Plaza to the Supreme Court Building, across from the Capitol, during the day. Their activities and those of counterdemonstrators grew increasing tense and took a violent turn in the early evening. Videos posted to social media showed numerous incidents of shoving and punching as well as a fireworks explosion and a man shoving and knocking down one person before being shoved and punched unconscious himself by others.

https://apnews.com/article/nearly-2-dozen-arrested-trump-protests-2f5cfab681cf0bbee785fcc1a4209701

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

f8a88a  No.12310914

File: a9091770ad55551⋯.jpeg (428.41 KB, 1218x1709, 1218:1709, 485A6B59_33CE_4C3E_B5FF_D….jpeg)

File: e5cabec8de6a9cf⋯.jpeg (625.71 KB, 1194x2080, 597:1040, 3FED0EA7_1BC9_441B_973F_1….jpeg)

File: 35227d49759ecb2⋯.jpeg (162.68 KB, 1181x576, 1181:576, 0DF13AB6_F73A_4A86_8C8A_A….jpeg)

Bobby Piton insinuating a fake MSM hit piece coming out on him

BobbyPiton

@BobbyPiton3

Just got off the phone with a reporter (possibly MSM) That said, in IL it is against the law to record a conversation without permission. For the record, I did not grant permission to record my conversation. Since this is the case, I write up everything I discussed and share

10:32 AM · Jan 4, 2021·Twitter Web App

435

Retweets

9

Quote Tweets

1.4K

Likes

https://twitter.com/BobbyPiton3/status/1346117302719275010?s=20

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

fd75bf  No.12310915

>>12310911

blonde didn't trust you, he's still gonna give you your part

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

dee259  No.12310916

File: 34c09b4c8914847⋯.jpeg (259.9 KB, 640x642, 320:321, 63527523_A25A_4DFC_AFCE_E….jpeg)

>>12310872

>Lin wood hasn't said anything we haven't heard before. Not sure what the big revelation is here.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

3f3bcd  No.12310917

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

dcb9e0  No.12310918

File: f9165c430450573⋯.mp3 (157.31 KB, 2021_01_04T16_55_58.mp3)

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

04a674  No.12310919

File: ee245339022c9bd⋯.jpg (28.41 KB, 618x410, 309:205, trumpflag.jpg)

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

518715  No.12310920

>>12310893

All you need to do is watch the replay of live fox broadcast to see the Trump Numbers actually go down after a count is reported.

They showed their theft in full view, but they are all so compromised, that even full evidence is not enough to force a narrative change.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

fe08ec  No.12310921

File: 775892a3023f112⋯.jpeg (1.09 MB, 1111x1775, 1111:1775, F5E09A9E_66B2_4F00_BE4A_F….jpeg)

Planefag update:

KC135 over Oak Ridge with 2 Navy jets doing DefPats.

Possible threat against Oak Ridge by Iran?

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

dcb9e0  No.12310922

File: 287a65d919f6b0e⋯.mp3 (157.31 KB, 2021_01_04T16_56_30.mp3)

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

e34828  No.12310923

>>12310872

Hopefully he's building up to aliens and breeding programs.

That should really piss them off.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

4470a2  No.12310924

File: 7bc9acaae4ddde2⋯.png (16.08 KB, 530x209, 530:209, JohnCardillo_tweet2.png)

File: 39435e45be2881d⋯.png (21.99 KB, 529x212, 529:212, JohnCardillo_tweet3.png)

>>12310905

Forgot pics of tweets, kek sorry

Still waking up

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

55dc86  No.12310926

>>12310886

>10 former Pentagon chiefs

Ah, so those who were collectively in charge of the Pedo Pentagon? Gotcha.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

e2f0c4  No.12310927

File: 9d8951dd866bc0f⋯.jpg (25.18 KB, 550x366, 275:183, margot_robbie_hottest_sexy….jpg)

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

49fc32  No.12310928

>>12310872

Twat is a social media platform for normies, and is not a back channel. He is getting normie eyes on it to wake up those he can, but more importantly this puts the fact that he has the dirt into the spotlight. Will hopefully provide a modicum of protection that others who have tried to expose this shit have not had.

He is forcing the dark out into the light -

This also is a way to establish a public 'chain of custody' for the info so it doesn't look like POTUS pulled it out of his ass to smear political opponents

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

127ae9  No.12310929

File: 68bea83511b0ab6⋯.jpeg (316.66 KB, 1796x1032, 449:258, 0595C0CA_3F7F_4103_A3CF_C….jpeg)

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

abd828  No.12310930

>>12310239 (LB)

Who gave the order to stand down?

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

044b31  No.12310931

>>12310916

Cocaine is a hell of a drug.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

dcb9e0  No.12310932

File: a7c070c6f1e316d⋯.mp3 (157.31 KB, 2021_01_04T16_57_00.mp3)

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

aee2a0  No.12310933

>>12310904

Stop typing please

They can only coerce you to do that if you are already corrupt to begin with

An incorruptible person would never be in that position

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

1c13b5  No.12310934

File: fa7e5a9501c113c⋯.jpg (7.36 KB, 257x145, 257:145, bbf1caf196ffb5b5a8f3hf569b….JPG)

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

f508dd  No.12310935

File: adfdfad6124e225⋯.jpeg (334.7 KB, 1357x1266, 1357:1266, adfdfad6124e225622cc6cac6….jpeg)

>>12310788

Thank you, Baker!

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

9cb40c  No.12310936

File: c80e8813e0af618⋯.jpg (436.06 KB, 1300x732, 325:183, Maga_hat_babes.jpg)

>>12310788

Bowser calling in the Koopa Troopas to deal with millions of red-hat Marios chanting MAGA? It's doesn't get much more Nintendo than that.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

2bc6de  No.12310937

>>12310909

Excellent reply.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

ba7d7e  No.12310939

>>12310908

>You are correct, CJ.

who the fuck is cj?

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

6050a9  No.12310940

>>12310897

I would definitely put him in the cabal territory.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

3bb08e  No.12310941

File: 53228ce989bc0f2⋯.png (504.66 KB, 452x759, 452:759, unhinged.png)

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

fd75bf  No.12310942

>>12310926

the pentagon always does things times 3 1/3 so . . . 10 former Chief equals Three Blind Mice in real world terms.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

a29ff6  No.12310943

>>12310927

She needs to get her ass of the counter

get the bleach

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

1c13b5  No.12310944

File: 5010adc2d2a7e12⋯.jpg (41.03 KB, 888x485, 888:485, bidencompromised.jpg)

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

dcb9e0  No.12310945

File: f009086e8df2cbb⋯.mp3 (157.31 KB, 2021_01_04T16_57_57.mp3)

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

f5d86c  No.12310946

>>12310927

Man those legs look inviting!

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

91b08e  No.12310947

>>12310863

National Guard will have to make a choice. They are on the precipice too

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

3bb08e  No.12310948

>>12310927

fond memories

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

4d6d88  No.12310949

>>12310916

Lin Wood just throws out allegations with no proof.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

518715  No.12310950

>>12310873

Sorry, Q is gone fishing

But nice catch anon

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

4c76f7  No.12310951

>>12310863

"no DCNG personnel shall be armed during this mission…"

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

aee2a0  No.12310952

>>12310924

Time to start looking into John Cardillo

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

7dbde4  No.12310953

>>12310899

The Precipice refers (in my opinion) to the waking of the people.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

127ae9  No.12310954

YouTube embed. Click thumbnail to play.

>>12310863

This is how you March into battle. Massive numbers, armed to the teeth, singing your heart out.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

385563  No.12310955

>>12310946

dig, meme, pray!!!!!!!!!!!!!!!!!!!!!!!!!!

kek

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

dcb9e0  No.12310956

File: 8b7bd7c103998b5⋯.mp3 (157.31 KB, 2021_01_04T16_59_05.mp3)

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

4470a2  No.12310957

>>12310917

I noticed that too

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

666a80  No.12310958

File: 4d80bb71809083d⋯.jpg (115.25 KB, 1236x428, 309:107, not_title_10_yet.jpg)

doesn't the head of Joint Chiefs of Staff act as Governor for D.C.

in all Title 32 vs. Title 10 matters?

"under the guise of riot control"

no mention of vax dispersal

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

5af0a0  No.12310959

>>12310863

3 or so million pissed off americans in DC while Congress gives American people 100 Billion in covid relief but then gives 700 Billion to other countries and gives away American jobs with recent unlimited cap to H1-B… I mean what could possibly go wrong??

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

ef5c37  No.12310962

Trump phone call: Democrats ask FBI for ‘immediate criminal investigation’ in new letter

https://www.independent.co.uk/news/world/americas/us-election-2020/trump-phone-call-fbi-georgia-b1782130.html

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

3bb08e  No.12310963

>>12310872

he sure draws lots of shills for doing merely that, doesn't he.

reconcile.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

4e68dd  No.12310964

File: 69393317f3b17c2⋯.jpg (76.43 KB, 517x219, 517:219, getz.jpg)

Lets open the Clinton/China can of worms.

https://www.thegatewaypundit.com/2017/11/ex-clinton-foundation-exec-linked-chinese-kindergarten-investigation-alleged-child-molestation/

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

e18083  No.12310965

File: d8533c55acdcc37⋯.jpeg (164.94 KB, 647x995, 647:995, 72728272_D4D6_4B7E_B254_D….jpeg)

Put Pepe in!

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

fd75bf  No.12310966

Last night I read the story of how it's always windy beside a certain church in Rome . . .

interesting story the wind was told to wait for the Devil, as they were travelling together.

this is supposed to have happened a long long time ago, the Devil went into the church because he had a meeting with the Je su its in dare.

well The Wind is still waiting for that meeting to conclude.

from Secret Rome, a small tome worth a read

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

dcb9e0  No.12310967

File: 108f275c551e835⋯.mp3 (157.31 KB, 2021_01_04T17_00_01.mp3)

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

aee2a0  No.12310968

>>12310949

He gave you proof and the proof has been out there since the first pizzagate drop in 2015. Nice try but fuck off.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

9cb40c  No.12310969

>>12310872

Public recognition. Permeating the surface.

>>12310909

Well, anon's right. How does the public feel about Lin's tweets? I just talked to someone that has no clue who Lin is. Until people on the other side start reporting this stuff, we are still waiting for more mainstream saturation.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

18728d  No.12310970

>>12310909

Mark it 9, Dude.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

3bb08e  No.12310971

>>12310965

Pute Pepe BACK in.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

ba7d7e  No.12310972

>>12310863

That's the head scratcher.

The NG's have demonstrated that they will not touch real protesters, and will arrest rioters.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

6c4a2e  No.12310973

It’s a Planned Panic-demic.

It’s amazing what your own brain can do to you’re body while wrapped in fear. Keep filling people with propoganda their bound to stress their immune system into getting something. And despite the reports, covid didn’t kill ask other forms of death like a vicious monster virus. You probably got a cold.

Covid hoax

Johns Hopkins study explodes COVID death hoax; it’s re-labeling on a grand scale

https://canadafreepress.com/article/johns-hopkins-study-explodes-covid-death-hoax-its-re-labeling-on-a-grand-sc

https://archive.vn/Evla0

“only 6% of all coronavirus deaths were completely due to the coronavirus alone” cdc quietly reports

https://www.thegatewaypundit.com/2020/08/shock-report-week-cdc-quietly-updated-covid-19-numbers-9210-americans-died-covid-19-alone-rest-serious-illnesses/

https://archive.vn/JZNnm

But 3 million usa covid deaths in 2020!

https://archive.vn/j0V2g

Death by lightning, I mean covid.

https://archive.vn/dNWm6

Swedish death toll + change in death rates images

https://i.maga.host/fn9Vvql.png

https://i.maga.host/I2nvJgu.png America numbers

https://i.maga.host/ZtiGDth.png

No need covid gone (If it ever actually existed to begin with) https://www.lifesitenews.com/news/former-pfizer-vp-no-need-for-vaccines-the-pandemic-is-effectively-over

https://archive.vn/i8kNw

4.Antibodies wont last long enough? Antibodies last weeks. https://www.miamiherald.com/news/coronavirus/article244087867.html

https://archive.vn/YjUob

Antibodies?

28 days later:

https://www.outlookindia.com/website/story/world-news-moderna-vaccine-helps-antibodies-stay-active-for-90-days-reports/366157

https://archive.vn/09alU

Heard immunity unethical?! Johnson and johnson pause trials (unexplained illness)

https://www.infowars.com/posts/johnson-johnson-pauses-late-stage-covid-19-vaccine-trial-after-volunteer-becomes-sick/

https://archive.vn/WStO1

Who changes definition of herd immunity to mean vaccines

https://i.maga.host/2lIJ3Zq.png

Antibody passports? Pandemic expected for at least another year

https://worldisraelnews.com/israel-announces-green-passports-for-covid-19-recoverees-pandemic-expected-for-at-least-another-year/

https://archive.vn/V4k54

Death numbers would be so bad if medicinal people weren’t purposefully storing the deaths by killing the elderly “covid” patients. Euthanasia https://www.thesun.co.uk/news/12100515/care-homes-accused-sedatives-coronavirus-die-quickly/

https://archive.vn/27LqA

Where is the isolated virus?

https://www.lewrockwell.com/2020/12/jon-rappoport/the-sars-cov-2-virus-was-never-proved-to-exist/

https://archive.vn/WWKP2

Why sell out? Pfizer ceo sells most shares say vaccine launch.

https://financialpost.com/financial-times/why-the-pfizer-ceo-selling-62-of-his-stock-the-same-day-as-the-vaccine-announcement-looks-bad

https://archive.vn/nJzgJ

And Moderna too

https://www.bnnbloomberg.ca/moderna-chief-sells-more-shares-ahead-of-urgent-vaccine-filing-1.1526465

https://archive.vn/QXwaq

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

088e17  No.12310974

File: 8b5d0adee1b5490⋯.mp4 (374.75 KB, 480x360, 4:3, Jack_Benny_Remain_United.mp4)

Jack Benny: Remain United.

hold the line, frens

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

870559  No.12310975

File: 748f154fe3e912e⋯.jpeg (27.94 KB, 255x255, 1:1, 3973B43D_B45C_42BC_8217_5….jpeg)

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

404b7b  No.12310976

>>12310872

>Lin wood hasn't said anything we haven't heard before. Not sure what the big revelation is here.

The info has to be slowly fed to the public, otherwise it will be rejected.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

666a80  No.12310977

File: ec2b05a5dc6d12a⋯.jpg (54.72 KB, 612x408, 3:2, bow_wowser.jpg)

File: 21362cb82a8ed99⋯.jpg (629.06 KB, 748x797, 748:797, cat_logic.jpg)

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

5a98bb  No.12310978

File: 45a16fd58bc9db3⋯.webm (7.32 MB, 558x480, 93:80, Frazzledrip.webm)

>>12310924

Worldwide the number of missing reaches near 8 million annually, over 90% of which are women and children.

Even if 1% of those are victims of human trafficking, that's 220 a day that are sold into human trafficking rings.

That's a real fucking problem.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

7b1d05  No.12310979

File: 3f68f65a7b6806a⋯.png (391.02 KB, 1080x2160, 1:2, Screenshot_20210104_090001.png)

>>12310890

Hmm.

You change the res on this?

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

1e91c9  No.12310980

File: 681ac6bb54901f3⋯.png (880.85 KB, 890x499, 890:499, ClipboardImage.png)

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

252c00  No.12310982

>>12310949

Are you involved with the blackmail scheme?

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

cb893e  No.12310983

File: 2c37b15d8334f71⋯.jpeg (371.79 KB, 968x591, 968:591, 3A4B7F56_69CD_40C9_B846_4….jpeg)

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

9cb40c  No.12310984

>>12310939

CJ Truth from twitter.

https://twitter.com/cjtruth/

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

f5d86c  No.12310985

>>12310933

I'll tell you what.

DON'T tell me to stop typing

and I won't tell you to FUCK OFF!

Howbowdah dickwad?!

In MY PART of this board,

the FIRST AMENDMENT rides

HIGH and LOUD.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

8d25df  No.12310987

Notables Are Not Endorsements

#15715

>>12310914 Bobby Piton insinuating a fake MSM hit piece coming out on him

>>12310905, >>12310924 John Cardillo is unhinged because of Lin Wood

>>12310973 It’s a Planned Panic-demic.`

>>12310921 pf

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

dca983  No.12310988

File: a8912bb5832c93f⋯.jpeg (290.19 KB, 460x679, 460:679, 3867DA72_CAEE_4CB4_A4F0_A….jpeg)

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

3bb08e  No.12310990

File: 5a285a55d697ec9⋯.png (642.83 KB, 612x879, 204:293, Screen_Shot_2021_01_04_at_….png)

>>12310965

there are no autists

and only a few anons

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

2424f2  No.12310991

File: 2d5566d9ce09344⋯.jpg (28.08 KB, 255x255, 1:1, 2d5566d9ce093447d4b5faf161….jpg)

>>12310788

Thank You Baker!

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

a29ff6  No.12310992

>>12310969

>I just talked to someone that has no clue who Lin is

And it's YOUR JOB to inform them

smdh

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

ba7d7e  No.12310993

>>12310984

>https://twitter.com/cjtruth/

oh, ok. they suspended now

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

4d6d88  No.12310994

>>12310968

I've seen no video of anyone shooting a kid.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

bc083b  No.12310995

>>12310709 (lb)

>>12310761 (lb)

On his third low pass, wtf fuck is up here

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

af472d  No.12310996

File: 922c22d9d2ab139⋯.png (268.49 KB, 352x262, 176:131, Screenshot_2021_01_04_twin….png)

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

4b1a9a  No.12310997

>>12310872

Are you retarded?

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

18728d  No.12310998

>>12310949

A famous defamation lawyer wouldn’t say shit unless he can fully back it. The slow drip is starting to flow faster.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

088e17  No.12310999

File: 95bf64b8dfc6e17⋯.jpg (318.44 KB, 605x490, 121:98, Be_a_Baker.jpg)

>>12310889

Kek!

>>12310788

ThanQ Baker!

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

ebc401  No.12311000

Lucian Lincoln "Lin" Wood Jr.

https://na.leagueoflegends.com/en-us/champions/lucian/

Lucian, a Sentinel of Light, is a grim hunter of undying spirits, pursuing them relentlessly….

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

c960aa  No.12311001

File: 05fa2c6cd8930a7⋯.jpeg (52.71 KB, 750x526, 375:263, 88EB8F3A_F9B5_45B1_B25A_4….jpeg)

99.9% of humanity was assimilated into a hivemind three months ago.

No one really noticed.

Only now, the 0.01% are starting to put the pieces together

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

385563  No.12311002

File: c5b1145d95507a6⋯.jpg (4.26 MB, 3063x4430, 3063:4430, Tor_s_Fight_with_the_Giant….jpg)

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

9cb40c  No.12311003

File: 9f34ce233819bbf⋯.jpg (125.95 KB, 723x1080, 241:360, redhead_stunning.jpg)

>>12310992

Can't inform people that don't want to listen. I'm sure the plan has something in store for those folks, too, right? Anon does his part; trust me.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

8bd541  No.12311004

YouTube embed. Click thumbnail to play.

Georgia Sec. of State discusses phone call with Trump about election results l GMA

“For the last two months, we’ve been fighting a rumor whack-a-mole. It was pretty obvious very early on that we debunked every one of those theories, but President Trump continues to believe them.” “Everything we’ve done for the last 12 months follows the constitution of the state of Georgia, follows the United States Constitution, follows state law.”

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

1c13b5  No.12311005

My local news at noon just opened with the tape of Trump, describing it as him "begging Raffensperger to change election results."

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

ba7d7e  No.12311006

>>12310788

it's been a while.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

8d25df  No.12311007

File: aef3ce49784af9b⋯.png (382.52 KB, 706x770, 353:385, ClipboardImage.png)

Shadow strike.

A @usairforce

F-15E Strike Eagle prepares to continue its mission after refueling from a KC-135 Stratotanker over Southwest Asia.

https://twitter.com/DeptofDefense/status/1346139332969525249

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

f08cb6  No.12311008

>>12310993

>>12310993

Suspended CJ a couple weeks ago on Twitter. But he is still active on Gab and Parler

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

b02bb8  No.12311009

File: 144b15fb717ec02⋯.png (664.98 KB, 674x698, 337:349, alienzzz_moar.PNG)

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

4470a2  No.12311010

File: 62616fe2f7fd9a0⋯.png (313.93 KB, 529x604, 529:604, DoD_tweet.png)

https://twitter.com/DeptofDefense/status/1346139332969525249

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

50fd09  No.12311011

File: 44938cf7794b6b5⋯.jpg (102.57 KB, 500x549, 500:549, e12d18c27c2521aaadcb132e7d….jpg)

>>12310886

> by 10 former Pentagon chiefs

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

f56d94  No.12311012

>>12310969

Many I talk to know shit's fucked up, but just don't think anything will be done about it.

Blackpills have never been more popular.

So, while it's nice to see Lin and others putting it out on the line, it's basically reached the point where some action needs to take place in order to get the redpills flowing again.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

c6cd29  No.12311013

File: 53d75b3d747cf4a⋯.jpg (168.58 KB, 918x920, 459:460, 35f3b191f03031551af63f3faf….jpg)

File: 6fba5652bdf8006⋯.jpg (95.42 KB, 1941x1000, 1941:1000, 512DmIeQKKL_AC_UY1000_.jpg)

>>12310848

mind your Qs & Ps,

soli luna,

rule of two,

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

4d6d88  No.12311014

>>12310982

Nope, but where is the physical evidence?

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

252c00  No.12311015

To you fuckers that hurt the innocent for personal gain. Mother fuckers like me are out here waiting for the proof.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

dcb9e0  No.12311016

File: a0ba38fcabbf20b⋯.mp3 (157.31 KB, 2021_01_04T17_04_29.mp3)

>>12310967

-=

====

1

2

3

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

a29ff6  No.12311017

File: 75d1a2c20d0c181⋯.jpg (48.86 KB, 500x500, 1:1, negro.jpg)

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

42e15f  No.12311018

YouTube embed. Click thumbnail to play.

All assets deployed.

Lin has really struck a nerve. Do you midwits really think you will be able to change the narrative here?

KEK

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

1ed846  No.12311019

File: d91468849aee1bd⋯.png (148.82 KB, 478x501, 478:501, Screenshot_2021_01_04_The_….png)

Meanwhile in CA…

https://twitter.com/washingtonpost/status/1346069136519159814

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

088e17  No.12311020

File: 2197461f4a9236e⋯.jpg (189.67 KB, 768x768, 1:1, 08bf5b50734c399a90af488c91….jpg)

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

696780  No.12311021

File: b4b5e3c5968ca10⋯.jpg (687.83 KB, 1917x959, 1917:959, X_C30s_4_Jan_20_1700.jpg)

File: 37caef370b2682f⋯.jpg (577.61 KB, 1917x965, 1917:965, Various_4_Jan_21_1700.jpg)

File: a4e32a634378694⋯.jpg (523.58 KB, 1917x967, 1917:967, R01053_4_jan_21_1700.jpg)

R10153 at a Coastal Station close to Cherry Point. Two more 'X' C-30J flights out of Dyess.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

4dce7a  No.12311022

File: d08a9eac82998eb⋯.png (16.16 KB, 973x268, 973:268, THESSALONIANS_2_11_KJV_And….png)

>>12310920

>They showed their theft in full view, but they are all so compromised, that even full evidence is not enough to force a narrative change.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

1a7844  No.12311023

>>12310906

Go deeper with those thoughts, anon. What does that tell you?

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

a1b27b  No.12311024

>>12310939

No idea. I thought it was maybe the nickname for Grant Stinchfield, but he never mentioned '17:17' being a notable.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

f56d94  No.12311025

>>12310976

>slowly fed

That's nice but 1/20 is right around the corner.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

a29ff6  No.12311026

>>12311015

>Mother fuckers like me are out here waiting for the proof.

mofos like you are just fucking DUMB.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

f08cb6  No.12311027

>>12310886

Yeah, NBC, don't be writing that "living" part of these traitors in stone.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

4c76f7  No.12311028

>>12310904

It looks like a tangled shit pile of all of the above. If it's on tape it has the same effect no matter how it got there. Q said some were forced into bed with evil and that others were already there.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

23434a  No.12311029

File: dc5d37ad48b7de4⋯.jpg (33.92 KB, 1032x774, 4:3, droopy.jpg)

File: a5d86392f7d8aba⋯.png (Spoiler Image, 224.74 KB, 597x386, 597:386, tb.png)

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

4470a2  No.12311030

>>12310994

Thats because…

ITS AGAINST US LAW TO POST VIOLENCE AGAINST CHILDREN

Fuckstick

Use your brain.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

949102  No.12311031

File: 476c3c2debe694e⋯.png (991.38 KB, 1433x2754, 1433:2754, Capture_2021_01_03_20_06_5….png)

File: 0eb66bd7fd62ba7⋯.png (1.31 MB, 1439x2809, 1439:2809, Capture_2021_01_03_20_07_2….png)

File: 81301d5edb42bf4⋯.png (1.3 MB, 1439x2824, 1439:2824, Capture_2021_01_03_20_08_0….png)

>>12311005

Yeah they are all over that section of the tape. Desperate. And why? Do they think he isnt actually going anywhere? Pics related.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

af7243  No.12311033

>>12310914

He's a dumbass for even talking to them.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

c5a8a2  No.12311034

File: 51a50d6fd4d0295⋯.jpg (457.97 KB, 612x879, 204:293, xkp87rnvd.jpg)

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

349a29  No.12311035

>>12311004

> “Everything we’ve done for the last 12 months follows the constitution of the state of Georgia, follows the United States Constitution, follows state law.”

lying mofo!

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

e2f0c4  No.12311036

File: e4fb2bc81b980f2⋯.jpg (54.75 KB, 500x500, 1:1, image_2.jpg)

>>12310946

Leg man!

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

748849  No.12311037

File: f6723c327dafb10⋯.png (360.38 KB, 576x929, 576:929, Screenshots_2021_01_04_09_….png)

>>12310863

National Guard will be there at the imagnary Biden inauguration also.

Soon, thousands of National Guard members will descend upon Washington, D.C. to begin preparing to support the 59th presidential inauguration of President-Elect Joe Biden.

So far, Army and Air Guard commands from nearly 30 states have pledged to support what has become a huge tradition for the citizen soldiers.

https://www.military.com/daily-news/2021/01/02/thousands-of-national-guard-troops-prepare-support-bidens-inauguration.html

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

4dce7a  No.12311038

>>12311023

>What does that tell you? >>12311022

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

546cb4  No.12311039

Just like the deep state is taking full advantage of COVID-19, /our guys/ should do the same.

HINT: Check Q's first post ever and think what is very easy to do now compared to pre COVID-19 world.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

5a98bb  No.12311040

File: 53845f0af2693bb⋯.webm (9.92 MB, 854x480, 427:240, SHOCKING_footage_from_ins….webm)

>>12310979

here have the whole thing

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

0e80d5  No.12311041

Some of this is less than urgent

I want it down though, for the record

>>12309227 pb

Well that's a good thing

F - U to the Deep State.

Now all the Clinton emails and the rest that has been disclosed can be perfectly valid journalistic FREEDOM OF SPEECH with documentation.

and not some "Stolen in the Night" forgeries

Screw you Hillary, if you're even still alive

>>12304558 pb

"good cia officer,

good for whom, for Britain?

Sounds like an oxymoron

Also, SO THEY ADMIT THEY'RE in the secret agent business.

Is that why the FF's have to create an enemy?

>>12304589 pb

just looking at it this morning checking it again

STAGED SHOT

Those severed beams adroitly placed next to the human figures in the foreground

2 of them only

Are meant to suggest Themite / Thermate which was pushed by the controlled "Truth movement"

Could be even a shoop job ith the foreground.

Thermite / Thermate isn't the answer and that's why it's pushed so hard.

They started with Thermite; and when that wa show to be a DUD - can't explain the forensics; then they moved to Thermate, hopeing peeps would be bamboozled and agree with the sold out "engineers" that Thermate could explain

I hope they have to give back ten times the suffering they created

But do Psychopaths suffer?

They need to be outed publicly. No more "We won't tell"

"think of the families"

Now it's not about the families of thevictims who WOULD want to know the truth

ITS ABOUT THE FAMILIES OF THE PERPS

"PLEASE DON'T TELL, WHY MAKE OUR FAMILIES SUFFER bOO HOO

AND THAT S THE WHOLE BUSINSESS OF "let them retire with grace, have a noble funeral"

FUCK THAT

they need to be outed

Thank-yous to Lin S. for understanding who the real victims; and who fights for the real victims and not for the "family members" of the PERPS

BOO HOO

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

d39445  No.12311042

>>12310994

Seems like something like that would have leaked at some point, especially dealing with celebrities, politicians, etc.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

385563  No.12311043

aliens..hehe

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

aee2a0  No.12311044

>>12310994

I’ve seen no evidence that you bothered to do any reading of the evidence he posted nor have you gotten off your lazy ass and did any research or critical thinking

Fucking lazy ass retard is what you are

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

a1b27b  No.12311045

>>12310964

Didn't Q drop a post of a tall guy in Hong Kong, alluding to children?

Same guy who was wearing red shoes in another pic Q dropped?

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

6d5d25  No.12311046

>>12311010

Twelve O'Clock High

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

a118fd  No.12311047

File: 3c3f092ab1bb4f3⋯.png (427.47 KB, 536x384, 67:48, hillary_china.png)

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

0e80d5  No.12311048

File: c127d7902c1ae9c⋯.jpg (215.29 KB, 1050x1846, 525:923, iassackappymindmap.jpg)

File: ba338a34a1d3aac⋯.jpg (155.92 KB, 507x659, 507:659, worldunionofsocialists51.jpg)

File: 399fa5bf38b3981⋯.jpg (154.19 KB, 1125x1256, 1125:1256, gameonk.jpg)

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

dcb9e0  No.12311050

File: 5986840edad4949⋯.mp3 (157.31 KB, 2021_01_04T17_07_01.mp3)

-----—-*****

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

1c13b5  No.12311051

>>12311031

"Criminal election tampering." kek

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

3bb08e  No.12311052

File: f8a16e6121f0e42⋯.png (720.22 KB, 613x899, 613:899, Screen_Shot_2021_01_04_at_….png)

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

6050a9  No.12311053

>>12310997

No. I can get better info on a Google search.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

9eaf72  No.12311054

>>12310863

Bowser needs to beware what she wishes for. She might not get the NG deployment she wants.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

56c68e  No.12311055

File: a788c10901ec13c⋯.png (196.11 KB, 691x435, 691:435, 40789106943.png)

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

e5ddbb  No.12311056

YouTube embed. Click thumbnail to play.

A physics lesson on the MODES of heat transfer and why all modes obey the same basic principles, such as heat flowing from hot to cold only.

Also discussed is the strange situation climate science academia finds itself in today, with its believing in and active support of total pseudoscience.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

c960aa  No.12311057

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

40927e  No.12311058

>>12310905

Cardillo:DONT LOOK HERE, LOOK THERE

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

ae69bb  No.12311059

File: e2ebbfd368ac3a2⋯.jpg (70.66 KB, 500x554, 250:277, War.jpg)

Ultra stealth MAGA Patriots…

Stealth drones that the government developed don't even know are in the MAGA Patriots hands… Why because their fathers left this technology for urban warfare.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

a29ff6  No.12311060

File: dbe41f85db55525⋯.png (355.64 KB, 513x546, 171:182, flynn1.png)

>>12311037

the NG will be there to restore law & order and protect the POTUS. Donald J. Trump.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

4e68dd  No.12311062

File: 6b0c2232dfdc18e⋯.jpg (154.39 KB, 640x592, 40:37, cyrus_paedo_avatar.jpg)

File: 0c0cdd59529cdad⋯.jpg (118.58 KB, 592x341, 592:341, pan_man_boy_paedo.jpg)

Can we start stacking bodies yet? Asking for a nation…

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

b0b660  No.12311063

>>12311019

Death rate inflated much. Kek

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

65da4c  No.12311064

>>12311004

Last two months, we've been fighting the rumor of Whack a Mole?

Awww, don't you know who the mole is?

Not sure who RATTED you out RATTBURGER?

Could have picked a better Zoom Background that one is kind of CHEESEY. Pillows look like Rabbits…

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

55dc86  No.12311065

>>12310979

https://breakthematrix.com/blog/breaking-vice-video-shows-christchurch-shooting-victim-checking-facebook-status-watch/

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

8bd541  No.12311066

>>12311035

Thinking..he's too far gone now..he has to stick to his story. He already knows it doesn't matter for him either way..he goes down..nothing can stop what the future holds for him in Gitmo.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

ad03d0  No.12311067

File: ecbef4e13a51580⋯.png (83.81 KB, 300x300, 1:1, Aliens.png)

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

d39445  No.12311068

>>12311054

They were going to be there anyway, just not for her.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

1ed846  No.12311069

File: 296c5186f526c68⋯.png (293.48 KB, 535x527, 535:527, Screenshot_2021_01_04_The_….png)

Biden Promises Nationwide Mask Mandate And Womandate

https://twitter.com/TheBabylonBee/status/1346131807985692674

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

e34828  No.12311071

File: f507f471b98459a⋯.png (548.42 KB, 1280x720, 16:9, ClipboardImage.png)

File: c62eb1f4f5bc9e8⋯.png (817.99 KB, 736x379, 736:379, ClipboardImage.png)

File: f048690ce1c0811⋯.png (579.82 KB, 681x423, 227:141, ClipboardImage.png)

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

286c63  No.12311072

Fake news is spewing the narrative that what the R Senators and others are doing, those who will dispute the electoral count, is UNDEMOCRATIC.

They don't ever say that what they are doing is UNCONSITUTIONAL…

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

ec5417  No.12311073

File: 6c8418a442d9bb0⋯.png (377.4 KB, 720x430, 72:43, Cupace20210104100124.png)

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

4d6d88  No.12311074

>>12311044

The normies do not have time for that. They need physical proof shown to them. Where is it? not just some creepy pictures that insinuate something.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

c55e5a  No.12311075

File: 22ac7d3710cf808⋯.jpg (296.07 KB, 600x904, 75:113, bread.jpg)

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

dcb9e0  No.12311076

File: 1ecea825f26f40e⋯.mp3 (157.31 KB, 2021_01_04T17_08_50.mp3)

-*----

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

ba7d7e  No.12311078

>>12311064

something something hoisted… petard…

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

91b08e  No.12311079

>>12310941

>>12310941

>>12310941

Amen and Awoman anon

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

49fc32  No.12311080

File: 254af8c75722731⋯.jpg (297.95 KB, 1080x1662, 180:277, 20210104_110803.jpg)

Moving the Overton window on COVID?

Cheap hair lice drug may cut risk of COVID-19 death by 80 percent: study

https://nypost.com/2021/01/04/hair-lice-drug-may-cut-risk-of-covid-19-death-by-80-percent/

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

163a98  No.12311081

>>12310863

Why do the old timers call the NG the ‘pappy shooters’? What does that mean??

Are Dems trying to have to NG hurt or kill protesters??

Wtf..

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

022f3c  No.12311082

>>12310998

or, he knows exactly how much he can say and still stay out of court.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

a1b27b  No.12311083

File: d34d056b923d3c7⋯.png (226.75 KB, 1575x1479, 525:493, ClipboardImage.png)

File: 516983c62c73375⋯.png (185.43 KB, 1580x1418, 790:709, ClipboardImage.png)

>>12311037

>https://www.Military.com

https://who.is/whois/military.com

CSC CORPORATE DOMAINS, INC.

ALL (DISINFO) ASSETS DEPLOYED

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

cd1184  No.12311084

>>12310914

Bobby Piton

interdasting fact….

pi·ton

/ˈpētän/

noun

a peg or spike driven into a rock or crack to support a climber or a rope.

Movie

Bobby is a 2006 American drama film written and directed by Emilio Estevez, and starring an ensemble cast featuring Harry Belafonte, Joy Bryant, Nick Cannon, Laurence Fishburne, Spencer Garrett, Helen Hunt, Anthony Hopkins, Ashton Kutcher, Shia LaBeouf, Lindsay Lohan, William H. Macy, Demi Moore, Martin Sheen, Christian Slater, Sharon Stone, Freddy Rodriguez, Heather Graham, Elijah Wood and Estevez himself. The screenplay is a fictionalized account of the hours leading up to the June 5, 1968, shooting of U.S. Senator Robert F. Kennedy in the kitchen of the Ambassador Hotel in Los Angeles following his win of the 1968 Democratic presidential primary in California

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

f5d86c  No.12311086

>>12311019

Here we go.

Which round of COVID are we on now?

3rd?

4th?

California cocksuckers!

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

95d7d9  No.12311087

File: 06b6411988dc604⋯.jpeg (32.77 KB, 634x269, 634:269, 1F21983E_6CDE_4255_8FBB_8….jpeg)

>>12310983

Eli might want to back down before it’s too late

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

e34828  No.12311088

File: 925b86d3b834dc3⋯.jpg (69.1 KB, 466x443, 466:443, fully_erect_2.jpg)

>>12311043

Come on man, I'm losing a lot of blood over here

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

f8a88a  No.12311089

File: 1452cf9b08d0d72⋯.jpeg (386.9 KB, 1194x1661, 1194:1661, D5AC01B7_1307_49BF_8A67_6….jpeg)

File: 8affe1a5e548d40⋯.jpeg (56.13 KB, 680x510, 4:3, BCD455E5_B394_4639_AB5A_1….jpeg)

https://twitter.com/ScottAdamsSays/status/1346093264642818053?s=20

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

dcb9e0  No.12311090

File: e54fa79cffb8ba5⋯.mp3 (157.31 KB, 2021_01_04T17_09_50.mp3)

-*---

i due no

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

367d5f  No.12311091

>>12311081

>Are Dems trying to have to NG hurt or kill protesters??

* Are Dems trying to have the NG hurt or kill protesters??

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

5a5936  No.12311092

>>12310814 LB

There’s a difference between stupid and ignorant. There are all levels here. Perhaps YOU need to read up on definitions of “chan” and “kun.” If you are so wise, you should be educating the others. Cussing them out is only causing division.

They want us divided.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

7b1d05  No.12311094

>>12311040

I was up that night on 8chan.

Posted photo of the graffitied rifle (pointed out the little girl's name)

I don't know where I stand with the whole thing now, after having watched many, many vids.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

2234b7  No.12311095

File: c94730e24737528⋯.jpg (327.94 KB, 706x770, 353:385, full.jpg)

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

235da0  No.12311096

>>12310789 (last bread)

NOTABLE

>The 1973 Home Rule Act, which granted the District limited autonomous authority, contains provisions for the “emergency control of police” via a federal takeover of the D.C. police.

To invoke that act, the president would have to determine that “special conditions of an emergency nature exist which require the use of the Metropolitan Police force for federal purposes.” The takeover may last up to 48 hours and may be extended with approval of the members of Congress that oversee District affairs, the act states.

https://www.washingtonpost.com/local/public-safety/dc-police-takeover-george-floyd/2020/06/02/856a9744-a4da-11ea-bb20-ebf0921f3bbd_story.html

HINT HINT Boss

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

47cf17  No.12311097

File: 85ed5ecd110eda9⋯.jpg (75.25 KB, 300x229, 300:229, 3team.jpg)

File: 8d223136531158c⋯.jpg (148.75 KB, 657x838, 657:838, planepattern.JPG)

File: 9a0540f20747410⋯.jpg (115.89 KB, 839x595, 839:595, waller.JPG)

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

2424f2  No.12311098

File: 4543bcd4d0b9419⋯.png (1.35 MB, 1366x896, 683:448, Screen_Shot_2021_01_04_at_….png)

File: d4d6e7c5ec5e3cc⋯.png (1.26 MB, 1202x898, 601:449, Screen_Shot_2021_01_04_at_….png)

Congress Approves Rules Regulating Jan. 6 Electoral Vote Count

January 4, 2021

The House of Representatives and the Senate on Sunday adopted rules that outline how the counting of Electoral College votes will take place on Jan. 6.

The rules were passed without recorded votes. Instead, a voice vote was used in both chambers.

The guidance, introduced by Senate Majority Leader Mitch McConnell (R-Ky.), says the chambers will meet in a joint session on Jan. 6 presided over by Vice President Mike Pence.

Pence, as president of the Senate, will open “all the certificates and papers purporting to be certificates of the electoral votes,” the rules state, a nod to how seven states sent so-called competing electors, or certificates for both Democratic presidential nominee Joe Biden and President Donald Trump, to Washington.

The certificates and papers will be opened, presented, and acted upon in alphabetical order, starting with Alabama.

This is when dozens of Republicans—50 representatives and 12 senators, according to an Epoch Times tally—are planning to object to some certificates, alleging election irregularities including voter fraud and failure to follow state election laws.

That will trigger a withdrawal from the joint session and a two-hour debate, followed by votes in each chamber. Only with a majority vote from both the House and the Senate would a challenge be upheld, which even supporters find unlikely, considering Democrats who control the House and Senate Republican leadership, including McConnell, have expressed disapproval with the plan to object.

House Speaker Nancy Pelosi (D-Calif.) in a letter to colleagues on Sunday noted that objections can happen but said, at the end of the day, Biden “will be officially declared the next president.”

“On Monday, we will have a clearer picture of how many state votes will be subject to an objection. Our choice is not to use the forum to debate the presidency of Donald Trump,” she added.

Reps. Ron Estes (R-Kan.), Tracey Mann (R-Kan.), and Jacob LaTurner (R-Kan.) said Sunday they will join in the objections, saying in a statement that several states are “facing serious allegations of voter fraud and violations of their own state law.”

“This action is not taken lightly and comes after extensive study and research. Kansans deserve to know that all legal, and only legal, votes were counted. We hope our actions begin to restore the confidence of tens of millions of our fellow Americans that feel their sacred right to vote is under attack,” they added.

Reps. Jim Jordan (R-Ohio) and Richard Hudson (R-N.C.) also announced Sunday they’ll object.

But seven Republican representatives, including several strong Trump supporters, said they will not join in the effort, and denounced the move.

“Of the six states as to which questions have been raised, five have legislatures that are controlled by Republicans, and they all have the power to send a new slate of electoral votes to Congress if they deem such action appropriate under state law. Unless that happens between now and Jan. 6, 2021, Congress will have no authority to influence the outcome of the 2020 presidential election,” the group wrote in a statement.

“To take action otherwise—that is, to unconstitutionally insert Congress into the center of the presidential election process—would amount to stealing power from the people and the states. It would, in effect, replace the Electoral College with Congress, and in so doing strengthen the efforts of those on the left who are determined to eliminate it or render it irrelevant.”

The weekend saw a flurry of action, with 11 senators following Sen. Josh Hawley (R-Mo.) in announcing they’d join in the objections unless Congress appoints a commission to examine alleged election irregularities. The idea is modeled on the panel formed in 1877 amid a contested election.

Hawley’s Dec. 30 announcement triggered a number of House members to announce their intention to object. The number planning to do so has more than doubled since then.

A segment of Republicans are focusing on Pence’s role in the proceedings. They sued the vice president and asked a court to rule he has the “exclusive authority” to decide between dueling electors.

A judge dismissed the case and an appeals court rejected an appeal.

Pence had asked the court to dismiss the suit but said through a spokesman on Saturday that he supports efforts to challenge electoral votes.

“Vice President Pence shares the concerns of millions of Americans about voter fraud and irregularities in the last election,” Pence’s chief of staff, Marc Short, said in the statement sent to media outlets.

https://www.theepochtimes.com/congress-approves-rules-regulating-jan-6-electoral-vote-count_3642381.html?utm_source=news&utm_medium=email&utm_campaign=breaking-2021-01-04-2

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

ba7d7e  No.12311099

>>12311086

The new strain is called covid 5… thousand.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

07d1f1  No.12311100

>>12310622 lb

>>12310921 lb

OK, I found it

The Blacklist Button

https://8kun.top/qresearch/res/12117594.html#q12118644

This is for eliminating images you never want to see again.

(I wonders how you get them back if you make a mistake - oh well)

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

6c4a2e  No.12311101

Once you take the red pill, it's almost like you're living in a completely different world.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

518715  No.12311102

>>12310994

snuff films and child pornography are against the law, if you searched out the evidence mentioned, you would have had to use research tools beyond this board to see that.

P.S. - don't try it, you seem too stupid to realize once on your computer you are now accessory to a crime.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

a31a04  No.12311103

File: 89b75a43584ce1a⋯.png (281.3 KB, 408x291, 136:97, lin_wood_can_and_will.PNG)

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

f5d86c  No.12311104

File: 13130b2e861c40a⋯.png (146.99 KB, 920x349, 920:349, ClipboardImage.png)

I like this pic better than the usual

masked Asian chicks .

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

385563  No.12311105

File: 2dd9fdb8a8ef096⋯.gif (1.94 MB, 344x191, 344:191, adolfsalute.gif)

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

56c68e  No.12311106

File: 9d6580ececea317⋯.png (200.03 KB, 691x435, 691:435, 010876436053.png)

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

17a2ff  No.12311108

File: de3ff337e5d7f29⋯.jpeg (119.45 KB, 676x456, 169:114, D7D0EF51_F01B_4AAE_B9D3_3….jpeg)

File: 1be37b0ed85c8f7⋯.gif (1.58 MB, 480x270, 16:9, A0614ACA_2CE1_46F9_8148_07….gif)

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

fd75bf  No.12311109

So if I do travel it'll be with this story:

"I have a self published site and I am 'working' the 'poltical protest' so you have no authoritae to do anything more than show me your cheery eyes and wish me well in my travels or assist me should I need you too, sir or maddam or whatever you prefer to be called."

if you book in Md they might say '10 daze at the BaccchhhQue of the Buzss' to the detention quarantine facilitattatae unless you have an authorizzed by my pension funds test for the phake-en-gay virus.

that even if you get the test it means nothing except it enriches those who give it or provide it.

anyway, so ya, if you stay in PA or MD and even NJ you need to be worried about hassles. (wait, I didn't find out about NJ

only VA seems hassle free but they still have the brain-dead 'you must wear a mask inside' requirement.

if you are on business they give you a pass in MD and PA but not sure about NJ.

the point of the 'free commerce' clause is so that we don't have to deal with this.

as it is I have to buy a card to use the subway and give them money up front . . .

or to park and face the question 'mame, where is your test result'.

I have a quilting website and I'm doing business research on patriotic quilt designs so I'm on business travell and you can't harm me.

but they don't want to harm me.

all the quarantine and test requirements are uncivil hazing.

I run a fishing website and I'm doing reserach on trout at the Reflecting Pool because I heard it's going to be the national surfing tidal pool slash national trout pond when renovations are done and toxic waste sites removed from local buildings nearby and in the view of better buildings, needing to have expanded basements like they would do in the old world (just build it into a vault and build on top of it.

)

we could do a recreation of the Pallantine Hill circa 300 AD . . . complete with a hipodrome and a surfers pool . . .

and a 'Graftaneum': with monuments to various grafts, grifts, and shameful appropriation shinanagins . . .

is it a Griftnaeum of a Graftnaeum?

Naeum, niaum? you can call the whole thing off but the people still want fair elections.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

a31a04  No.12311110

File: 76016165b2e578c⋯.png (284.28 KB, 370x362, 185:181, lin_wood_come_get_some.PNG)

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

6c4a2e  No.12311111

File: 73d79be62060271⋯.jpg (43.1 KB, 480x360, 4:3, marshall.jpg)

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

c960aa  No.12311112

>>12311101

Ir timeline

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

a31a04  No.12311113

File: 00e138217a80f16⋯.png (922.76 KB, 900x1041, 300:347, 00e138217a80f1614d83df1866….png)

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

c78e02  No.12311114

File: 58e4528f788d99b⋯.gif (5.45 MB, 480x378, 80:63, info_overload.gif)

Current mood.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

3bb08e  No.12311115

>>12311101

wth no friends.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

022f3c  No.12311116

File: 66b4887fa64f811⋯.png (227.97 KB, 581x611, 581:611, Rush_GP_Dec_11_20.png)

File: 5c8c82381aaad82⋯.jpg (53.52 KB, 640x490, 64:49, Rush_Awarded_Medal_Freedom.jpg)

File: 7d9a692d0212e4f⋯.jpg (384.78 KB, 640x720, 8:9, Rush_and_Catherine.jpg)

Rush not back on the air today. Hope he is still winning the battle.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

ae69bb  No.12311117

File: a7cf7a7ccc87360⋯.jpeg (153.51 KB, 1284x709, 1284:709, 530E4F9F_F33F_4A39_A89F_6….jpeg)

>>12311060

MAGA Patriots: General Flynn is a pile of shit. Ask him about the 500 thousand Christian people killed under his watch….. Fuck you general Flynn.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

47cf17  No.12311118

File: c10db62468d2870⋯.png (2.3 MB, 2140x2140, 1:1, c10db62468d2870090e68288f9….png)

File: 68ad9793ada9bad⋯.gif (756.23 KB, 640x480, 4:3, 68ad9793ada9bad1cad2811e12….gif)

File: 0c3041d84e3d787⋯.jpg (6.48 MB, 4288x8368, 268:523, 0c3041d84e3d78786380132454….jpg)

File: bd3fb21d8ef93c1⋯.jpg (213.29 KB, 1096x767, 1096:767, debris.JPG)

>>12311097

If the entire frame of the WTC's was steel - then we should have seen it melt into a pile by the official story, not collapse into dust.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

2234b7  No.12311119

File: 19e9b7a13c07e19⋯.png (1.27 MB, 1280x853, 1280:853, martial.png)

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

4b1a9a  No.12311120

>>12311074

WHO CARES ABOUT THE NORMIES ANYMORE??

They will either ride the wave or drowned.

Release it all!

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

17a2ff  No.12311121

>>12311111

Check’d

Martial Law it is!

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

dcb9e0  No.12311122

File: 6909cfa774d05d5⋯.mp3 (157.31 KB, 2021_01_04T17_12_08.mp3)

-*--

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

b157a2  No.12311123

File: 759ecb3e4203695⋯.jpg (234.82 KB, 616x460, 154:115, anonpepe2.jpg)

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

3bb08e  No.12311124

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

ba7d7e  No.12311125

>>12311101

>worldview

fify

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

ef5c37  No.12311126

File: 254d8689aa72657⋯.png (382.88 KB, 539x398, 539:398, press_appease.png)

File: b69f151d8111d3a⋯.png (21.94 KB, 421x484, 421:484, press_app_ice.png)

Precipice

–Press Appease

—Press app ice…(!)

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

b068d6  No.12311127

File: 2e12eaca8e58bb8⋯.jpg (177.42 KB, 1080x1080, 1:1, 2e12eaca8e58bb8b875ddb3749….jpg)

>>12311004

High ground.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

a31a04  No.12311128

File: 23b537ac4e52818⋯.png (78.41 KB, 198x338, 99:169, 23b537ac4e52818df02f8f33ec….png)

>>12311111

>11:11:11

>12311111

holeymoley anon, chkt!

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

f5d86c  No.12311129

>>12311103

Killer looks like what's his name

from what's that movie.

Axe through the door, face peeking in,

what was it he said again?

"Heeeere's Johnny."

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

dcb9e0  No.12311130

File: 01943f2cc656c06⋯.mp3 (157.31 KB, 2021_01_04T17_12_40.mp3)

-*-****//

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

8d25df  No.12311131

Notables Are Not Endorsements

#15715

>>12310914 Bobby Piton insinuating a fake MSM hit piece coming out on him

>>12310905, >>12310924 John Cardillo is unhinged because of Lin Wood

>>12310973 It’s a Planned Panic-demic.`

>>12311007, >>12311010 Shadow strike.

>>12311080 Cheap hair lice drug may cut risk of COVID-19 death by 80 percent: study

>>12311089 How the fake news industry manufactures hoaxes

>>12311096 The 1973 Home Rule Act

>>12311098 Congress Approves Rules Regulating Jan. 6 Electoral Vote Count

>>12310921, >>12311021 pf

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

3bb08e  No.12311132

anons, wtf do you park if you're headed to DC from NE?

No, anon does not want to meet you.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

228a39  No.12311133

Raffensberger thinks by saying "That's not true" or "We got different numbers" without showing proof, will make this all go away.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

0f175b  No.12311134

>>12310903

this partly for pushing them into the satanist matriarchal societal model

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

e34828  No.12311135

>>12311101

And trying to tell enlighten others about all of it is the craziest mindfuck ever.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

49fc32  No.12311136

File: 3c49b942551cf27⋯.jpg (244.62 KB, 1080x1216, 135:152, 20210104_111153.jpg)

>>12311081

They may try this old trick again. FF incoming, blame the NG. They will not succeed if they attempt

https://en.m.wikipedia.org/wiki/Kent_State_shootings

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

cb893e  No.12311137

File: 63a158b3ce1398e⋯.jpeg (561.63 KB, 856x623, 856:623, 9BFD56CC_FDCF_4230_ABB9_E….jpeg)

>>12311120

Normies comply. Just a matter of who’s in charge.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

a29ff6  No.12311138

>>12311117

oh fuck you, faggot

He's a fucking General. A military man. People die. You are a fucking homo.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

235da0  No.12311139

>>12311096

>>12310742

>>12310704

"I was looking for info on her ability to shut down travel in DC, and I came across an article that mentioned a little known ACT that allows POTUS to force her to hand over control of DC police. He has 48 hours after doing it to notify Congress."

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

47cf17  No.12311140

File: 38e4c6d0c9c2048⋯.png (591.5 KB, 872x1112, 109:139, theyknow.png)

File: c04d1d75f9e92c8⋯.jpg (141.96 KB, 1000x893, 1000:893, f2275f76f29d6d4f06e64c1a80….jpg)

File: a2be1866b5e250b⋯.jpg (102.19 KB, 510x660, 17:22, EZDbqdJ.jpg)

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

404b7b  No.12311141

>>12311025

>1/20 is right around the corner

Q111: The complete picture would put 99% of Americans (the World) in a hospital.

Q142: The truth would put 99% of people in the hospital. It must be controlled.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

a31a04  No.12311142

mike pence wife owned by chyna?

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

3bb08e  No.12311143

File: 7b6acf51ab34edf⋯.png (331.78 KB, 585x397, 585:397, Screen_Shot_2020_12_24_at_….png)

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

5ca7df  No.12311144

YouTube embed. Click thumbnail to play.

Lin Wood Fireside Chat 4, Is Jeffrey Epstein Alive? Can Vice President Pence Be Trusted? + 100%

https://youtu.be/M27I3k-AV6c

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

666a80  No.12311145

File: ed8dfc1b0f5dd04⋯.jpg (105.16 KB, 750x499, 750:499, ping_Mr_Ryan.jpg)

File: cb52c7b35483b6b⋯.jpg (153.97 KB, 888x499, 888:499, may_be_not.jpg)

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

f08cb6  No.12311146

>>12311133

Why not? It has worked for the Uni-Party traitors for decades!

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

a31a04  No.12311147

>>12311129

red rum!

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

a29ff6  No.12311148

>>12311132

ever use a map?

gonna need more than your looks this time.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

3bb08e  No.12311149

spin spin spin!

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

5a98bb  No.12311150

>>12311094

a 17yr old New Zealand kid is in jail for sharing the exact video I posted. He might be 18 now, since it's been a while, he may even be 19, but he's still in jail.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

4a8786  No.12311151

File: 6c3747c35e29292⋯.png (738.95 KB, 1000x654, 500:327, ClipboardImage.png)

New rules on removal of illegal online content could help in battle against child pornography

smoke screen for censorship

Ottawa drafting legislation to require removal from websites within 24 hours. A December 2019 mandate letter sent to Guilbeault by Prime Minister Justin Trudeau called for his department to create new regulations that would require social media platforms and adult websites operating in Canada to remove illegal content within 24 hours or face "significant penalties." The heritage minister says the coming regulations will apply to any company operating in Canada, regardless of where they are registered, where their head offices are located or where their servers exist.

https://www.cbc.ca/news/canada/manitoba/canada-illegal-online-content-child-porn-1.5847695

The letter

Create new regulations for social media platforms, starting with a requirement that all platforms remove illegal content, including hate speech, within 24 hours or face significant penalties. This should include other online harms such as radicalization, incitement to violence, exploitation of children, or creation or distribution of terrorist propaganda.

https://pm.gc.ca/en/mandate-letters/2019/12/13/minister-canadian-heritage-mandate-letter

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

518715  No.12311152

>>12311101

Those that know, don't sleep well if at all. The version of reality we are in is fluxing due to a time war effecting movie outcomes.

Start tracking your own list of mandela effects

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

d5b32d  No.12311153

booby, you lost the board, faggot.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

1ed846  No.12311154

File: c2868e71a5089a0⋯.jpg (45.11 KB, 856x482, 428:241, look1.jpg)

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

3bb08e  No.12311155

>>12311148

useless asshole filter.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

a31a04  No.12311156

>>12311132

do you have a place to stay? park at hotel and i would call ahead to let them know you're almost there.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

e2f0c4  No.12311157

File: 66db8955577a30d⋯.gif (1.78 MB, 432x288, 3:2, 1607900020957.gif)

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

beff4d  No.12311158

>>12310872

>>12310381 pb

^^^THIS

Until LLCool Wood drops the sauce, all we got is dry-ass pasta.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

ae69bb  No.12311159

>>12311138

>>12311138

Shut your Chinese cocksuker asshole mouth@~

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

546cb4  No.12311160

>>12310863

Just so everyone is aware, Mayor BOWSER has no authority over DC NG. That power belongs to President Trump only due to DC's unique status. So this is just worthless piece of paper which has no authority to back it up.

"Trump has free rein in D.C. because of the city’s unique constitutional status. We only have “home rule,” granted by Congress, not sovereignty; we have no governor, so the D.C. National Guard answers to Trump, not to Mayor Muriel E. Bowser

https://www.washingtonpost.com/outlook/2020/06/05/dc-is-one-city-where-trump-can-indulge-his-police-military-fantasies/

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

d72ab3  No.12311161

File: 47ada969db8032c⋯.png (1.44 MB, 795x784, 795:784, ClipboardImage.png)

File: fcbeb4eddfc64a2⋯.png (823.46 KB, 581x785, 581:785, ClipboardImage.png)

>>12311117

nice digits

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

4c76f7  No.12311162

>>12311133

Anon would be ashamed if POTUS was even a tiny fraction as upset with me as he was with Raffensturdburgler. And he was being gracious on that call. kek

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

3bb08e  No.12311163

>>12311156

nah. commuting.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

a29ff6  No.12311164

>>12311135

yeah? try being anon in Nov 2017.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

666a80  No.12311165

File: 0703d682ac1ff5a⋯.jpg (63.13 KB, 750x619, 750:619, r_d.jpg)

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

f08cb6  No.12311166

>>12311117

never happened. But thank God he dusted shitloads of muslims!!

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

870559  No.12311168

File: 3949f805bc7c951⋯.png (238.46 KB, 498x385, 498:385, D3E9288B_03A3_4F39_B087_E0….png)

>>12311101

Welcome!

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

a31a04  No.12311169

>>12311011

fkn svd

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

eaad9b  No.12311170

>>12310872

Exaclty.

The bots are here to make him seem insane.

LOL. that will never work.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

7af217  No.12311171

File: 320719cac59e237⋯.jpeg (249.61 KB, 600x579, 200:193, E7F49BB8_D3AB_459F_97A3_B….jpeg)

>>12311101

>Once you take the red pill, it's almost like you're living in a completely different world.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

b157a2  No.12311172

>>12311152

I lose track of at least one whole day a week. whoosh

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

a5b386  No.12311173

File: fa78bfda46187c0⋯.png (223.16 KB, 500x334, 250:167, fa78bfda46187c09685a0b2724….png)

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

e306e9  No.12311174

>>12311132

Find a train station as close as you wanna go, park there, ride the train into DC.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

4d6d88  No.12311175

>>12311098

So it seems like a President Biden to me.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

8bd541  No.12311176

>>12311072

They want everyone to believe this country is a democracy..which is why they use words like undemocratic.

You will never catch them uttering the word REPUBLIC.. which is what this country really is..

Not a memer..but distinguishing the differences here would be an important meme.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

4dce7a  No.12311177

>>12310863

She is on prescription psychotropics. In a big way.

Those drugs block you from the Holy Spirit.

People who take Trunalimunumaprzure(tm) should not be the position of making decisions for the well-being of others. The streets of DC are not like your home town.

Her signature almost even looks like she is trying to copy BHO's. kek

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

349a29  No.12311178

File: d95de1064ff3fa4⋯.png (1.18 MB, 471x930, 157:310, ClipboardImage.png)

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

2234b7  No.12311179

File: cd8017598db523b⋯.png (196.76 KB, 518x790, 259:395, control.png)

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

47cf17  No.12311180

File: e1e665a03f58769⋯.jpg (172.31 KB, 468x640, 117:160, cartoon006.jpg)

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

a29ff6  No.12311181

File: aabef496afd7a94⋯.png (740.84 KB, 992x911, 992:911, potus_laugh.png)

>>12311159

the little faggot is triggered! LMFAO

kek kek kek

so fucking FUNNY to see you sperg out

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

42e15f  No.12311182

>>12311115

Dumbing yourself down to have relationships is truly painful. Told a long time close friend recently that I would slap the shit out of anyone who murmurs the word "covid" in my presence. He wasn't taking the hints otherwise.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

e2f0c4  No.12311183

File: e491009dfe77a5f⋯.png (1.04 MB, 1180x1400, 59:70, e491009dfe77a5fde0280bb949….png)

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

dcb9e0  No.12311184

File: ddb0c4181eae612⋯.mp3 (157.31 KB, 2021_01_04T17_17_12.mp3)

**–

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

000000  No.12311185

>>12311111

Checked

I guess its all settled then…

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

a31a04  No.12311186

>>12310872

the problem that normies have with it, is that it's exactly what all these "crazy conspiracy theorists" ie. anons, anyone questioning the narrative, as being correct. it fucks with their cognitive dissonance.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

e34828  No.12311187

>>12311164

I was there.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

3bb08e  No.12311188

>>12311174

ain't gonny mask anon

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

ea3c45  No.12311189

Father, as I walk this path that you have set before me, let me take time to thank Mother earth for allowing me to walk upon her green grasses, for brother sun who shines brightly upon me, for the 4 brothers of the winds who send the sweet scent of flowers to me, and for the gift of sister moon who shines to guide me through the night.

WA DO

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

8d25df  No.12311190

Notables Are Not Endorsements

#15715

>>12310914 Bobby Piton insinuating a fake MSM hit piece coming out on him

>>12310905, >>12310924 John Cardillo is unhinged because of Lin Wood

>>12310973 It’s a Planned Panic-demic.`

>>12311007, >>12311010 Shadow strike.

>>12311080 Cheap hair lice drug may cut risk of COVID-19 death by 80 percent: study

>>12311089 How the fake news industry manufactures hoaxes

>>12311096, >>12311139 The 1973 Home Rule Act

>>12311098 Congress Approves Rules Regulating Jan. 6 Electoral Vote Count

>>12311160 Mayor BOWSER has no authority over DC NG. That power belongs to President Trump only due to DC's unique status.

>>12310921, >>12311021 pf

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

a29ff6  No.12311191

>>12311108

fuckin A.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

1ed846  No.12311192

File: a59dd95a51ea297⋯.jpg (48.37 KB, 680x453, 680:453, MJZdtSQ7.jpg)

https://twitter.com/Not_the_Bee/status/1345512562897661953

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

dcb9e0  No.12311193

File: 32405ce3540806e⋯.mp3 (157.31 KB, 2021_01_04T17_17_46.mp3)

*/*/-*--

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

fd75bf  No.12311194

So years from now will they make a Cannonball run type movie about all the people who are road tripping to WAshington DC tomorrow night and how just make it in time to see . . .

well only some people know that, I sure don't.

If I can't get there I'll send my prayers and be vigilant during it and watch it live.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

c6cd29  No.12311195

File: 4848e34c619c8ca⋯.jpg (109.89 KB, 1500x833, 1500:833, 71BkUjkFlgL_AC_UL1500_.jpg)

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

748849  No.12311196

File: 24b915ac6947bd9⋯.png (1.17 MB, 986x966, 493:483, Alexander_Vindman.png)

File: 419d3ac83e2e3bf⋯.jpg (23.74 KB, 621x414, 3:2, newscred_adam_demarco_3000….jpg)

File: 944a563396c14a2⋯.jpg (472.51 KB, 2048x1366, 1024:683, 170810_mattis_bezos.jpg)

File: a510e93d44f76bb⋯.jpg (109.4 KB, 1862x1048, 931:524, longhorns_cropped_internal.jpg)

>>12311060

>>12311083

I know it might be hard for many here to accept but not all military is /ourguys/

We've seen evidence of this over and over since the digital war began.

>Vindman

>NG Whistleblower, Adam Demarco

>Mattis

>McRaven

But muh Martial law. But muh military tribunals!

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

eaad9b  No.12311197

>>12310949

BOT IS MAD

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

dcb9e0  No.12311198

File: 820a0bd6c4bb110⋯.mp3 (157.31 KB, 2021_01_04T17_18_17.mp3)

-*////*-

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

83a1be  No.12311199

File: b36f6be4653b51d⋯.jpg (225.27 KB, 1161x1411, 1161:1411, JosephSTEALin.jpg)

File: 045928df811fe6e⋯.png (42.62 KB, 281x299, 281:299, NOworries_GOTyourBACK.png)

File: 0d9e493d651b8be⋯.png (1.6 MB, 1392x788, 348:197, ClipboardImage.png)

File: 5853d13bf485d22⋯.png (1.18 MB, 1032x750, 172:125, vii_11_3_then_10_2_JoeBY_D….png)

>>12311069

>https://twitter.com/TheBabylonBee/status/1346131807985692674

>Mandate And Womandate

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

546cb4  No.12311200

>>12310947

They don't have to respond to this at all because President Trump controls DC National Guard, not the Mayor. I hope Major General Walker knows the law too.

https://www.washingtonpost.com/outlook/2020/06/05/dc-is-one-city-where-trump-can-indulge-his-police-military-fantasies/

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

a29ff6  No.12311201

>>12311187

ok then. you must know how much EASIER it is now. People are catching on.

As Q said, it will happen FAST.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

ef5c37  No.12311202

There were 18 attempted calls from the White House to GA secretary of state's office, sources say

https://edition.cnn.com/2021/01/04/politics/trump-brad-raffensperger-calls-georgia/index.html

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

c6cd29  No.12311203

File: 920cb1c12df9dbe⋯.png (244.07 KB, 860x639, 860:639, 360_3608151_golden_emblem_….png)

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

193173  No.12311204

Guise I have a hunch:

MSM and all the talking heads

are missing the whole point of

POTUS 45 Trump

allowing himself to be recorded

telling GA

he only needs

11,780 votes

to be SPECIFIC.'

POTUS is alerting

to all who are paying attention

THEY ALREADY HAVE IT ALL

allowing GA fu*ks traitors

THEM

to be the ones on the phone being recorded

to be aired worldwide as KNOWINGLY lying.

Trump is all COMMS

as to what is up

and what is about to go down

A'ND WHAT THEY KNOW'

It is all a Q troll all day long and they bite every time.

11,780 adds up to 17 which is Q COMMS'

BUT EVEN MORE IT IS A CALL TO DIG ???

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

c55e5a  No.12311205

File: 072d671d954665d⋯.jpg (107.64 KB, 360x504, 5:7, cct.jpg)

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

2234b7  No.12311206

File: 49a6e07e64eca2d⋯.png (399.19 KB, 1280x459, 1280:459, skyeye3.png)

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

503d27  No.12311207

>>12310863

>Mayor Bowser is requesting support by the NG for Jan. 6th.

Anon sees it just the opposite. It's to neuter them. Note: No DCNC personnel shall be armed, at no time, will DCNC personnel or assets be engaged in domestic surveillance searches, or seizures of US persons.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

aee2a0  No.12311209

>>12311045

Yes and we discussed whether it was we >>12311074

Again lazy as you appear to be THERE ARE FUCKING PROOFS ALL IVER THE PLACE YOU ARE HERE

FIND THEM OR GO BACK TO NORMIEVILLE

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

4dce7a  No.12311210

File: 0ad27cb16baaa94⋯.jpg (52.33 KB, 800x792, 100:99, WEF_1984.jpg)

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

193173  No.12311211

>>12311204

LOOK and THINK guise : 'find 11.780 votes' IS A THING for us to dig on

'

now PAY ATTENATION AS we ARE TO SEE THIS

11780 IS comms

Trump is telling them and us HE KNOWS something regarding 11780

Go to Duckduckgo safe search off

Simply type in 11780 Q

'''It AUTOMATICALLY takes you to the ANSWER tab, not to the tab for All or Images or Videos or News or Maps, it just goes to the ANSWER tab. I did not ask it to or direct it to the ANSWER TAB

When there look and THINK:

https://duckduckgo.com/?q=11%2C780+Q&atb=v225-1&ia=answer

It is pointing us to a lot of topics

A DIGG SHOULD ENSUE all things 11780 Q

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

a29ff6  No.12311212

>>12311196

please try to use your brain. Do you have one?

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

56c68e  No.12311213

File: 7b9300370d930a9⋯.png (200.87 KB, 691x435, 691:435, 101956837609347612.png)

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

870559  No.12311214

File: a05f626dc584544⋯.png (29.21 KB, 554x657, 554:657, 3197FD32_8086_43D1_B602_64….png)

>>12311117

Sloppy job Mossad

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

ef5c37  No.12311215

Resurfaced Video Of Dems Objecting to Electoral College Votes is BRUTAL

https://rumble.com/vcfb31-resurfaced-video-of-dems-objecting-to-electoral-college-votes-is-brutal.html

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

349a29  No.12311216

File: d4d616f3f9fd2df⋯.png (27.51 KB, 513x313, 513:313, ClipboardImage.png)

@michellemalkin

"FUCK PAUL RYAN."

https://twitter.com/michellemalkin/status/1345848117900398593

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

52ecf6  No.12311217

Hoping POTUS uses those rally big screens for some DECLAS. It's a powerful tool. Always thought it would be good to put some screens and loudspeakers in front of protesters to show them some facts about the criminals.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

a31a04  No.12311218

>>12311177

>Her signature almost even looks like she is trying to copy BHO's. kek

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

18728d  No.12311219

>>12310994

Then clearly you haven’t dug far enough. Best gore dot com has normal murder shiz. If you seek the crazy shit you gotta bust into dark web territory. Hell, even on Usenet and Torrents there’s plenty of illegal F’ed up shit. I’ve unintentionally seen plenty to last a lifetime.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

c6cd29  No.12311220

File: 1ab6ba5e1344038⋯.jpg (13.47 KB, 262x192, 131:96, index.jpg)

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

193173  No.12311221

>>12311204

the items that populate are curious indeed:

MASS

11780

Metric "Q"uintal = 1178000000

Trump, GA, WAPO, FARK.com (11070772) Dis Trukp break state and federal, adresses in SAINT JAMES, NY, Who lives at,

Covid-19 product Hillyard- HIL0016700 Q.T. information for a hard surface disinfectant that is effective,

MOVIE THEATER TIMES,

then another link for the Hillyard Covid-19 cleaner,

Allstate Insurance Ryan Dittmar, Saint James, NY,

radioation dose from X-ray scatter,

ADDRESSES in SAINT JAMES, NY

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

d1be3e  No.12311222

>>12311118

What’s your point? That the towers didn’t have 47 steel box columns running through the core of the structure? Or something else?

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

a1b27b  No.12311223

File: d8c7da625258a38⋯.png (201.83 KB, 557x898, 557:898, FedRIP.png)

File: b00adfecb1fed40⋯.jpg (726.78 KB, 1200x1392, 25:29, FEDRIP2.jpg)

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

bc083b  No.12311224

>>12311115

Probably ostracized myself from one of the hockey teams I play on last night at a team party… fuck em. If we are right they will have to come around sooner or later

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

e306e9  No.12311225

>>12311188

wear a nice western bandanna. Pull it up, let it fall, no one much says anything.

I don't wear em myself, or any mask, just so I can yell at someone if they say something to me, but that's me. I plainly don't give a fuck for any authority save that of our Creator.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

81359e  No.12311226

File: 25125c0fd93efd4⋯.png (85.88 KB, 375x360, 25:24, 790.png)

File: 9799b8ac41ab23d⋯.png (545.18 KB, 1467x1121, 1467:1121, 251.PNG)

File: a68aaf08337bcef⋯.png (602.33 KB, 994x701, 994:701, 250.PNG)

File: 483a5214626a4d5⋯.png (164.27 KB, 1114x858, 557:429, 249.PNG)

File: d6d6a343f1654d4⋯.png (165.83 KB, 828x345, 12:5, 248.png)

Here the deal my ATS friend

Ya my 3 day ban turn into a life ban

Your next

Please add any new one here

New _Ghost Drop on ATS

http://files.abovetopsecret.com/files/img/kl5eb8a558.png

http://files.abovetopsecret.com/files/img/bu5eb8a579.png

http://files.abovetopsecret.com/files/img/qa5eb8a5a0.PNG

http://files.abovetopsecret.com/files/img/lf5eb8a6de.PNG

http://files.abovetopsecret.com/files/img/mn5eb8a6fd.PNG

http://files.abovetopsecret.com/files/img/yf5eb8a7f7.PNG

http://files.abovetopsecret.com/files/img/zh5f68b760.png

http://files.abovetopsecret.com/files/img/or5fa0bb4b.PNG

New one Dec 12/20

http://files.abovetopsecret.com/files/img/wm5fd55bfa.PNG

New One Dec 28/2020

http://files.abovetopsecret.com/files/img/ca5feada9c.PNG

https://endchan.net/qanonresearch/res/48336.html#48510

https://endchan.net/qanonresearch/res/48336.html#49389

https://endchan.net/qanonresearch/res/49106.html#49628

https://endchan.net/qanonresearch/res/49106.html#49651

https://youtube.com/watch?v=iMhDySGyI9E

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

ec5417  No.12311227

File: 41a5fa4ef68883b⋯.jpg (142.17 KB, 720x907, 720:907, 20210104_101858.jpg)

File: 18d58683fc78ca4⋯.jpg (37.33 KB, 720x405, 16:9, 20210104_101836.jpg)

File: 0eca2ac835a906f⋯.jpg (333.42 KB, 1920x1080, 16:9, 20210104_101833.jpg)

https://twitter.com/KyleHooten2/status/1346142068670922753?s=19

Looks like protestors may have replaced an American flag with the Somali flag in south Minneapolis

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

9c9792  No.12311228

File: cac86ba5fc89981⋯.png (21.46 KB, 615x170, 123:34, ClipboardImage.png)

>>12311022

Ideo mittet illis Deus operationem erroris ut credant mendacio,

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

9a3f48  No.12311229

>>12310704 (pb)

re NG and DCMPD on 1/6

Find And Stay Near Veterans (milanons) AND Leave in Groups

Took my teen kids to the Inauguration in 2016. The NG AND the DCMPD completely STOOD DOWN as pantifa disrupted ALL the long lines to enter the parade route and flood the Mall. There were easily 500 - 750K of us who were prevented from entering through the few security gates. All of us MAGA families were pissed off and complaining to the PD and NG (ALL were black, BTW) and they thought it was the funniest thing ever as they openly allowed pantifa to stand in large groups blocking each of the entrances. Once we all realized what was going down after POTUS speech ended we all headed to the Metros to escape the gangs of pantifa who had torched DC the previous nights. My advice would be to find and stick with groups of Veterans/anons and leave in groups at the end of the day. If you notice lone families or small groups, take them under your wing as you are getting near the end of the day. Try to help any stragglers you may run into as the walking dead will begin to show themselves as the sun gets low.

Remember

WWG1WGA!!!

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

0cdb7d  No.12311230

File: 9ac4932874072b5⋯.png (349.16 KB, 1915x849, 1915:849, ClipboardImage.png)

Odd place for a quake don't you think frens.

https://earthquake.usgs.gov/earthquakes/map/?currentFeatureId=us6000d5g7&extent=21.9838,-130.16602&extent=51.78144,-59.85352

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

b157a2  No.12311231

File: 71ec91cfd056dcf⋯.png (1.6 MB, 1181x1335, 1181:1335, trumpdyn.png)

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

3bb08e  No.12311232

>>12311216

crush intensifies

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

193173  No.12311233

>>12311204

The very first and all other items that come up are

Q.11780: In the public sector, as opposed to the privat

Q.11780: In the public sector, as opposed to the privat

Search domain www.briefmenow.org/isc2/in-the-public-sector-as-opposed-to-the-private-sector-due-care-is-usually-determined-by-2/www.briefmenow.org/isc2/in-the-public-sector-as-opposed-to-the-private-sector-due-care-is-usually-determined-by-2/

ISC question 11780: In the public sector, as opposed to the private sector, due care is usually determined byA. Minimum standard requirements.B. Legislative

GA, Trump, Covid-19, addresses in Saint James, NY, MOVIE THEATER TIMES, radiation scatter dose info, Allstate Insurance Ryan Dittmar, Saint James, NY,

and adressess????

FOR SAINT JAMES, NY

7 Fox Point Dr.

280 7th Ave

Northern Blvd

11 Pheasant Run

7 Carmen Ln

3 Hawks Nest

139 Woodlawn

576 LongBeach Rd

41 pLANE tREE lN

A link for Broadband Internet in Saint James 11780 zip code just is in the middle???

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

e34828  No.12311234

>>12311201

For certain parts of this, yes.

There is still a lot to go through though and some of it is still hard to believe for most, even here.

Rip the veil off, I'm all for it.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

2234b7  No.12311235

File: d0819194cef239c⋯.png (456.19 KB, 750x845, 150:169, indian.png)

>>12311220

was a nice prayer though

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

193173  No.12311236

>>12311204

An address IN GEORGIA also come up???

11780 Ashwick Pl, Alphretta GA that highlights being near SCHOOLS in Fulton county.

11780 Ashwick Pl, Alpharetta, GA 30005 | 25 Photos | MLS …

Search domain www.movoto.com/alpharetta-ga/11780-ashwick-pl-alpharetta-ga-30005/pid_q0vdn69lbh/for-sale/https://www.movoto.com/alpharetta-ga/11780-ashwick-pl-alpharetta-ga-30005/pid_q0vdn69lbh/for-sale/

11780 Ashwick Pl Alpharetta, GA 30005 is located in the Fulton County School District and the nearest school is Abbotts Hill Elementary School. an ideal family neighborhood with Chattahoochee High School highly rated assigned schools. Discover more about the Alpharetta.

THEN YOU GET A LINK TO A COVID -19 HARD CLEANER

Hillyard - HIL0016700 Q.T. with a registered trademark symbol which reads:'''

Hillyard - HIL0016700 Q.T.®

Search domain b2b.hillyard.com/productdetail/index/grid/wwsa/C~11865,PL~11780,PD~HIL0016700https://b2b.hillyard.com/productdetail/index/grid/wwsa/C~11865,PL~11780,PD~HIL0016700

HIL0016700 Q.T.® Q.T. (EPA Reg # 1839-166-1658 ) has demonstrated effectiveness against viruses similar to 2019 novel coronavirus (SARS- CoV-2) on hard, non-porous surfaces. Therefore, this product can be used against SARS-CoV-2, the novel coronavirus that causes the disease COVID- 19, when used in accordance with the directions for use against Rotavirus on hard, non-porous surfaces. <br …

THEN you get MOVIE TIMES AND MOVIE THEATERS IN 11780-LOCAL SHOWTIMES

theaters near you

'THEN again :

Hillyard - HIL0082400 Q.T.® Plus

Search domain b2b.hillyard.com/productdetail/index/grid/wwsa/C~11865,PL~11780,PD~HIL0082400https://b2b.hillyard.com/productdetail/index/grid/wwsa/C~11865,PL~11780,PD~HIL0082400

Q.T. Plus is designed for use on walls,countertops,fixtures,restroom and shower rooms,and other hard surfaces where disinfectint is a must. On 7/29/20, The EPA published updated label claims on List N for QT Plus as effective against SARS-CoV-2, the virus that causes COVID-19 with a 3- minute contact time.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

7b1d05  No.12311237

>>12311150

The ever-growing DS resort of tranny Jacinda.

The gun grab sealed it.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

c6cd29  No.12311238

File: 46f52bc87e75bf1⋯.gif (3.06 MB, 480x360, 4:3, JollyThirdGardensnake_size….gif)

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

b871f9  No.12311239

>>12310951

>>12310863

Yes, that seemed significant to me, too. By requesting, is he trying to dictate the terms of their engagement? I think I might actually prefer that they are armed and ready to defend citizens.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

748849  No.12311240

>>12311212

Tell me why I'm wrong or just continue to not provide evidence for why I'm wrong.

Would seriously appreciate to be wrong.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

f5d86c  No.12311241

>>12311147

Yup.

That's the one.

Still haven't watched that movie.

With the iconic snippets popping-up

repeatedly over the years, it seems like

I already had.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

ff34b8  No.12311242

File: 891b4d1d909793a⋯.jpg (17.54 KB, 474x316, 3:2, downloadfile.jpg)

MAGA Patriots: General Flynn is a pile of shit. Ask him about the 500 thousand Christian people killed under his watch….. Fuck you general Flynn….

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

a29ff6  No.12311243

>>12311101

>Once you take the red pill, it's almost like you're living in a completely different world.

not almost. It is.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

81359e  No.12311244

File: 599ad05f1e483b1⋯.png (511.78 KB, 1017x1083, 339:361, 246.PNG)

File: 174c439250c78f3⋯.png (620.64 KB, 1051x1100, 1051:1100, 214.PNG)

File: 2c6e69690126143⋯.png (570 KB, 1102x1011, 1102:1011, 212.PNG)

File: cc3c9a9cdd52dcb⋯.png (896.33 KB, 1090x824, 545:412, 211.PNG)

File: b84be7e478a6c12⋯.png (326.36 KB, 875x523, 875:523, 186.png)

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

4dce7a  No.12311245

File: 038c41a103ff60a⋯.jpeg (51.27 KB, 500x500, 1:1, I_ll_do_as_I_m_told.jpeg)

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

ba7d7e  No.12311246

>>12311176

democracy = direct vote as individual

republic = representative vote, with the STATES as the voters.

This is why the leftists do not like the EC.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

ad1cad  No.12311247

>>12311204

He probably said something with enough plausible deniability but also enough controversy that they would release the call if they were taping it.

Trump is a genius

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

47cf17  No.12311248

File: 6e0b31d9b066e55⋯.jpg (50.66 KB, 764x454, 382:227, 1400foraweek_.JPG)

File: c2b9dbc7eb247ca⋯.jpg (140.09 KB, 702x523, 702:523, c2b9dbc7eb247ca9a99ab26bd7….jpg)

File: b5aa240b9129713⋯.jpg (105.32 KB, 621x841, 621:841, wtcjet.JPG)

File: b3e7f50ff30597d⋯.jpg (117.81 KB, 836x655, 836:655, subter.JPG)

>>12311222

20 years living the lie.

This is the year we take the Truth out for all to see.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

193173  No.12311249

>>12311204

all should be looked at???

so much more that seems odd

all with the simple 11, 780 Q as the search:

SOME MAY BE NOTHING AT ALL OTHERS MAY BE SOMETHING????

https://clustrmaps.com/a/34q10d/

11780 Borman Dr, St. Louis, MO Public Records

Search domain clustrmaps.com/a/34q10d/https://clustrmaps.com/a/34q10d/

This address may be also written as 11780 Borman Drv, St. Louis, MO 63146.

We know about 48 companies registered at this address. These are some of the names: Nba Disciples Housing of Boise, Idaho, Inc and The Redemption Group Network. Nba Disciples Housing of Boise, Idaho, Inc is connected to this address through UCC records. Children's Hope International Foundation (licence Corporation Public Charity) and Children's Hope International/china's Children (licence Religious Organizations) are license holders registered here.. This address is #836 on the list of state addresses by the number of businesses registered there. WHOIS records associate this address with five domain names. Three registrant names found. This address may be also written as 11780 Borman Drv, St. Louis, MO 63146. 38.693957,-90.433225 are the latitude and longitude of the address location. Monthly rental prices for a two-bedroom unit in the zip code 63146 is around $1,110

qBittorrent

Wrong number of torrents with tracker problems displayed …

Search domain github.com/qbittorrent/qBittorrent/issues/11780https://github.com/qbittorrent/qBittorrent/issues/11780

Please provide the following information qBittorrent version and Operating System v4.2.1, windows 8.1 If on linux, libtorrent-rasterbar and Qt version (type here …

Blue Geri Velvet Queen Bed | GeriNavy-Q

Search domain www.meridianfurnitureusa.com/sitefiles/product-1437-11780/geri-bed-blue.htmlhttps://www.meridianfurnitureusa.com/sitefiles/product-1437-11780/geri-bed-blue.html

queen size Geri Velvet Bed in blue features soft midnight navy velvet, gold & chrome legs included, piping on headboard and footboard, contemp…

https://www.meridianfurnitureusa.com/sitefiles/product-1437-11780/geri-bed-blue.html

Weird Chinese game shit thta talks about SPELLS: https://www.op.gg/champion/cassiopeia/statistics/mid

s11 Middle Cassiopeia build guides, counters, guide, pro …

Search domain www.op.gg/champion/cassiopeia/statistics/midhttps://www.op.gg/champion/cassiopeia/statistics/mid

Cassiopeia build guides - op.gg provides builds, counters, guides, masteries, runes, skill orders, combos, pro builds and statistics by top, jungle, mid, adc, support …

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

299b63  No.12311250

>>12311229

notable

Anon advice DC Travel

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

af7243  No.12311251

For those interested, Sol Wisenberg has finally come out of the closet as the swamp rat he is. He's a calm, measured, and logical guy so his panic is hard to discern, but it's there nonetheless.

https://twitter.com/WisenbergSol

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

a29ff6  No.12311252

>>12311242

you fucking cunt KILL YOURSELF

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

50fd09  No.12311253

File: fca8c3a8b1916b3⋯.jpg (97.14 KB, 720x404, 180:101, Tactical_Goatcucks.jpg)

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

8bd541  No.12311254

>>12311204

Anon, remember when there was an overnight watch over the vote machines in GA.. CM reported that they were picked up in trucks and taken away?? Hmm wonder who has them?.. who really has them?

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

6ba4a6  No.12311255

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

c6cd29  No.12311256

File: a80a14fb9a5c878⋯.jpg (142.53 KB, 937x960, 937:960, 11416317_1401613743501335_….jpg)

>>12311235

not a chance, I believe th bible is a

cook book, it's not what you think

it says,

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

2c08a3  No.12311258

>>12310856 PB

Hmm…that makes you a cancer to humanity! Perhaps you could practice another way of existence!

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

0ddfc2  No.12311259

>>12311216

If I were so fortunate as to cuff Ryan, I might accidentally slam him into a door frame on the way out.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

07d1f1  No.12311260

>>12311242

I'll check out your suggested URL

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

193173  No.12311261

>>12311204

NO REFERENCE TO 11,780 Q, the search info, AT ALL

Best Korean BBQ Near Me - January 2021: Find Nearby … - Yelp

Search domain www.yelp.com/nearme/korean-bbqhttps://www.yelp.com/nearme/korean-bbq

Find the best Korean BBQ near you on Yelp - see all Korean BBQ open now and reserve an open table. Explore other popular cuisines and restaurants near you from over 7 million businesses with over 142 million reviews and opinions from Yelpers.

A 8,060.00 Chandlier link: https://www.build.com/allegri-11780/s890176

1 in stock CHROME

from the Quantum Quadro Collection

Allegri 11780 - Build.com

Search domain www.build.com/allegri-11780/s890176https://www.build.com/allegri-11780/s890176

Save up to 50% on the Allegri 11780 from Build.com. Low Prices + Fast & Free Shipping on Most Orders. Find reviews, expert advice, manuals & specs for the Allegri 11780.

MAY BE A WAY TO COMMUNICATE about software?

a link to ask and answer developers about BUGs in tech code and software quality

a stack eexchange network

with all sorts of links like:

Security implications of granting non-root access to privileged ports (<1024)

https://sqa.stackexchange.com/questions/11780/what-should-qa-ask-developers-they-are-interviewing

Software Tester Job Interview: Case studies on Test Design

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

a56189  No.12311262

>>12311005

It’s so tiring to always be in damage control mode for my lib acquaintances.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

91b08e  No.12311263

>>12311242

You scared, AJ?

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

aeb1f0  No.12311264

>>12310924

Nothing to see here.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

4a8786  No.12311265

File: 9f58dca4f340289⋯.png (632.42 KB, 607x686, 607:686, ClipboardImage.png)

>>12311242

cope faggot.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

9cb40c  No.12311266

File: e21dfee6f4d82d0⋯.png (19.44 KB, 749x154, 107:22, ClipboardImage.png)

>>12311232

Be careful who you follow, anon. Michelle Malkin:

https://twitter.com/michellemalkin/status/1245853793780002824?lang=en

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

a29ff6  No.12311267

>>12311240

The Remedial Reading Room is down the hall.

I don't teach dummays.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

193173  No.12311268

>>12311204

and this

may be nothing

The Knox School - Our Home Beside the Shore

Search domain www.knoxschool.orghttps://www.knoxschool.org

Join us on Saturday, November 14th at 7:30 PM for The Knox School's Virtual Production of Qui Nguyen's She Kills Monsters She Kills Monsters tells the story of Agnes Evans…

Field Office Locator | SSA

Search domain www.ssa.gov/locator/www.ssa.gov/locator/

Looking for a local office? Use one of our online services and save yourself a trip!

FLORIDA COMES UP???

11780 Seaview Dr, Vero Beach, FL 32963 | 23 Photos | MLS …

Search domain www.movoto.com/home/11780-seaview-dr-vero-beach-fl-32963-pid_1s0q67q8ahhttps://www.movoto.com/home/11780-seaview-dr-vero-beach-fl-32963-pid_1s0q67q8ah

11780 Seaview Dr Vero Beach, FL 32963 is located in the Indian River and the nearest school is Sebastian River High School. an ideal family neighborhood with Sebastian River High School highly rated assigned schools. Discover more about the Vero Beach. As of today, there are 337 properties listed for sale in ZIP code 32963 and 1,013 properties

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

c6cd29  No.12311269

File: cc143ff733e48bb⋯.jpg (131.03 KB, 1200x800, 3:2, 23705124_web1_190830_LAT_H….jpg)

>>12311253

bugaboo,

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

f5d86c  No.12311270

>>12311154

I tried to watch this movie.

Unsuccessful.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

81359e  No.12311271

File: c9fdb2acc717746⋯.png (139.72 KB, 880x554, 440:277, 182.png)

File: 526eddf0b8a9e39⋯.png (837.89 KB, 1519x719, 1519:719, 181.PNG)

File: f2f66903b6e711b⋯.png (416.17 KB, 1100x755, 220:151, 175.PNG)

File: e0db7ba3ba5067a⋯.png (540.42 KB, 1127x949, 1127:949, 165.PNG)

File: 44201bc3ed41945⋯.png (223.08 KB, 1080x2160, 1:2, 164.png)

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

ea3c45  No.12311272

>>12311206

>>12311220

It's a Cherokee new year prayer anon

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

4c76f7  No.12311273

>>12311239

>is he trying to dictate the terms of their engagement?

She. DC mayor made request.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

a1b27b  No.12311274

>>12311216

>>12311266

She can be wrong about Jared Kushner and right about Paul Ryan.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

ef5c37  No.12311275

sometimes it passes by and camouflages itself like a bot….

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

b02bb8  No.12311276

>>12311230

and at 5km depth too

Tyndall AFB

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

193173  No.12311277

>>12311204

CHINESE SHIT:

We believe in Star/Voice supremacy

salem9, Dec 17, 2020

Discussion in 'K-POP' started by salem9, Dec 17, 2020.

LOONA's comeback would've been waaay bigger if …

Search domain www.allkpop.com/forum/threads/loonas-comeback-wouldve-been-waaay-bigger-if.523092/https://www.allkpop.com/forum/threads/loonas-comeback-wouldve-been-waaay-bigger-if.523092/

JYPE H.Q. nuff-nuffs-nice said: … 11,780. They would have flopped no matter what. At least they sold some albums. Meh #9 atropos, Dec 17, 2020. hamsin5 likes this. FatesSoneCardi Public Figure.

https://www.allkpop.com/forum/threads/loonas-comeback-wouldve-been-waaay-bigger-if.523092/

DO YOU SEE 11,780 Q ANYWHERE IN THIS LINK THAT COMES UP FOR RAM STORAGE?

WHY DOES THIS PHONE COME UP??????

MI Poco M2 (Pitch Black, 6GB RAM, 64GB Storage): Amazon.in …

Search domain www.amazon.in/MI-Poco-Pitch-Black-Storage/dp/B08JCSS94Shttps://www.amazon.in/MI-Poco-Pitch-Black-Storage/dp/B08JCSS94S

16.59 cm (6.53 inch) Full HD+ Display 13MP + 8MP + 5MP + 2MP | 8MP Front Camera 5000 mAh Lithium Polymer Battery MediaTek Helio G80 Processor POCO M2 Has 6.53 inch display with resolution of 1080x2340 it has 2GHz+ 1.8GHz Dual plus Hexa Core Media Tek Helio G80 Processor, 5000 mAh LI-Polymer Battery, 18W of Quick Charge Android V10(Q) Operating System Dual GSM+GSM Sim , nano+nano , 4G VoLTE …

https://www.amazon.in/MI-Poco-Pitch-Black-Storage/dp/B08JCSS94S

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

c6cd29  No.12311278

File: 633f014cff3cd81⋯.jpg (26.13 KB, 324x339, 108:113, 4_5.jpg)

>>12311270

I've lived that movie,

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

91b08e  No.12311279

>>12311245

Kamala called me a racist but cmon man, she aint black

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

4a8786  No.12311280

>>12311271

fuck off tom

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

3a651c  No.12311281

File: c7e65c9572ef7aa⋯.png (338.66 KB, 640x1136, 40:71, 54327AAD_704C_4E4C_BB2B_BA….png)

File: b155cec3f48631f⋯.png (282.71 KB, 640x1136, 40:71, 90B37D55_75FC_4C1E_9417_43….png)

>>12310872

Allegory of the Cave Analogy

If my culture were trapped watching shadow puppets, and I wanted to predict our ability to escape the cave, one metric of key concern is percentage of population satisfied with the shadows vs those straining to see elsewhere.

In this way, comparing the public’s social media interaction with Lin Wood vs MSM is interesting.

Images related.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

a29ff6  No.12311282

>>12311258

think he was being facetious,

satirizing what (((they))) do

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

193173  No.12311283

>>12311204

AND THIS

ContentDialog ignoring CanExecute

"This seems like a bug, but seeing it hasn't been changed since '14, I'm wondering if this design is intentional."

ContentDialog ignoring CanExecute - Microsoft Q&A

Search domain docs.microsoft.com/answers/questions/11780/contentdialog-ignoring-canexecute.htmlhttps://docs.microsoft.com/answers/questions/11780/contentdialog-ignoring-canexecute.html

Welcome to our Microsoft Q&A platform! From the style of ContentDialog, there is a Button named PrimaryButton which represents PrimaryButton. It has bound Content, IsEnabled property, etc, but doesn't bind Command property, it should be why CanExecute has no effect. So you can use TemplateBinding to bind PrimaryButtonCommand with Command.

https://docs.microsoft.com/en-us/answers/questions/11780/contentdialog-ignoring-canexecute.html

DO YOU SEE ANYTHING THAT SAYS 11,780 Q ? BUT THIS COMES UP

Home - St. James Rehabilitation and Healthcare Center

Search domain stjamesrehab.comstjamesrehab.com

St. James Rehabilitation and Healthcare Center provides unprecedented levels of genuine care and customer service for our communities' Rehabilitation and Nursing needs, in a soothing, tranquil and state-of-the-art environment.

http://stjamesrehab.com/

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

1894cf  No.12311284

>>12311132

https://www.spotangels.com/washington-dc-parking

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

3bb08e  No.12311285

>>12311274

or right about both

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

8d25df  No.12311286

Notables Are Not Endorsements

#15715

>>12310914 Bobby Piton insinuating a fake MSM hit piece coming out on him

>>12310905, >>12310924 John Cardillo is unhinged because of Lin Wood

>>12310973 It’s a Planned Panic-demic.`

>>12311007, >>12311010 Shadow strike.

>>12311080 Cheap hair lice drug may cut risk of COVID-19 death by 80 percent: study

>>12311089 How the fake news industry manufactures hoaxes

>>12311096, >>12311139 The 1973 Home Rule Act

>>12311098 Congress Approves Rules Regulating Jan. 6 Electoral Vote Count

>>12311160 Mayor BOWSER has no authority over DC NG. That power belongs to President Trump only due to DC's unique status.

>>12311215 Video Of Dems Objecting to Electoral College Votes

>>12311229 Anon advice DC Travel

>>12310921, >>12311021 pf

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

3bb08e  No.12311287

>>12311284

anon, perfect.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

a1b27b  No.12311288

>>12311285

Or not right about one and right about the other.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

9cb40c  No.12311289

>>12311242

Evidence?

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

748849  No.12311290

>>12311267

Those who can't present evidence result to insults

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

c6cd29  No.12311291

File: 7b24d41de02161b⋯.jpg (40.46 KB, 468x300, 39:25, 12191570_1487987741530601_….jpg)

>>12311272

interesting,

you & others, ppl poppin they heads out th sand,

nice to see that ppl know what they lookin at,

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

2234b7  No.12311292

File: 862c4ce64d333bd⋯.jpg (454.15 KB, 812x1024, 203:256, light_vs_dark.jpg)

>>12311272

very beautiful

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

193173  No.12311293

>>12311204

again

some may be nothing

but a lot is in between the

different links that populate

OR THIS

Audi of Smithtown | Audi Dealership in Smithtown, NY

Search domain www.audiofsmithtown.comhttps://www.audiofsmithtown.com

Audi of Smithtown in St. James, NY treats the needs of each individual customer with paramount concern. We know that you have high expectations, and as a car dealer we enjoy the challenge of meeting and exceeding those standards each and every time.

https://www.audiofsmithtown.com/

Operators Manuals | Lincoln Electric

11780

IM10096

POWER MIG 256 - 11780

Search domain www.lincolnelectric.com/en-us/support/Pages/operator-manuals.aspx?type=code&q=11780https://www.lincolnelectric.com/en-us/support/Pages/operator-manuals.aspx?type=code&q=11780

Product Names and Code Numbers can be found on the name plate of welders and wirefeeders. In order to ensure you have the correct Operator's Manual for your machine you must use a Code Number Search.

https://www.lincolnelectric.com/en-us/support/Pages/operator-manuals.aspx?type=code&q=11780

Laqjuana Houser in Redford, MI - Bizapedia Profile

Search domain www.bizapedia.com/people/michigan/redford/laqjuana-houser.htmlhttps://www.bizapedia.com/people/michigan/redford/laqjuana-houser.html

Laqjuana Houser is listed as an Agent with Q's Raw Smoothies LLC in Michigan. The address on file for this person is 11780 Columbia, Redford, MI 48239 in Wayne County. The company is a Michigan Domestic Limited-Liability Company, which was filed on March 12, 2018.

Words That Rhyme With 11780 - Rhymes.net

Search domain www.rhymes.net/rhyme/11780https://www.rhymes.net/rhyme/11780

This page is about the various possible words that rhymes or sounds like 11780. Use it for writing poetry, composing lyrics for your song or coming up with rap verses. 11780 is the US ZIP code of Nesconset, Head of the Harbor, St. James, Smithtown, Stony Brook, Nissequogue - New York …

11780 Wellsley Way, Alpharetta, GA 30005 - Townhouse for …

Search domain www.apartments.com/11780-wellsley-way-alpharetta-ga/q9v0mxy/https://www.apartments.com/11780-wellsley-way-alpharetta-ga/q9v0mxy/

About 11780 Wellsley Way Alpharetta, GA 30005. Fabulous 3 sided brick townhome with 3 bedrooms and 3.5 baths, plus a two car attached garage. Chef's kitchen boasts granite countertops & wood floors all overlooking the dining area & fireside great room.

CHINESE YOUTUBE VIDEO GAME RECORDING

Pikmin 3 Deluxe: Side Stories - Day 1: Flower Garden 11780 …

Search domain www.youtube.com/watch?v=cMqDRH4q5-8https://www.youtube.com/watch?v=cMqDRH4q5-8

So the side stories do not seperate single and co op on the leader board. Oh well, still fun to run but about 24 seconds from WR on the board.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

81359e  No.12311294

File: 43fc2e9aecae832⋯.png (627.36 KB, 892x1124, 223:281, 162.png)

File: 46f3b6b00873bd9⋯.png (284.95 KB, 2160x1080, 2:1, 163.png)

File: 0acbd8430030bbc⋯.jpg (49.43 KB, 474x460, 237:230, 174.jpg)

File: 0e1d9d5a2c3d0c5⋯.jpg (219.67 KB, 600x600, 1:1, 176.jpg)

File: a1370d4144a9da2⋯.jpg (39.51 KB, 400x400, 1:1, 177.jpg)

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

4470a2  No.12311295

File: d1c2da16589bd18⋯.png (18.2 KB, 530x250, 53:25, JoshCaplan_tweet.png)

Inbox: Georgia secretary of state's office to hold press conference Monday at 3 P.M.

https://twitter.com/joshdcaplan/status/1346144530874175489

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

f08cb6  No.12311296

>>12311239

Who is 'he'? The mayor of DC is the nigger lesbian wife of Donna Brazile.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

07d1f1  No.12311297

>>12311266

this chick looks like her head got squished at birth

I have nothing against Kushner, so she is wrong there.

I hear a lot of hate, waiting for the proof. Muhjoo is not enough - never is.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

dcb9e0  No.12311298

File: 5b6312114e7426d⋯.mp3 (157.31 KB, 2021_01_04T17_25_42.mp3)

-*---

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

b7db35  No.12311299

>>12311126

>Precipice

>–Press Appease

>—Press app ice…(!)

Yeah, that's how this works… homonyms

Fuck's sake

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

a29ff6  No.12311300

>>12311290

those who are lazy ask others for evidence. Do your own fucking research. Convince yourself. I don't give a fuck what you believe.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

9cb40c  No.12311301

>>12311274

Precisely. As a matter of fact, that's exactly how the game is played.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

3bb08e  No.12311302

>>12311288

not sure that's an option, anon

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

7b1d05  No.12311303

>>12311248

I hope you're right.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

5a98bb  No.12311304

File: 8bd72f0cc1b74e3⋯.mp4 (719.48 KB, 394x240, 197:120, bionic_jerkoff_man.mp4)

Commas before Conjunctions, Anons?

What's the consensus?

I might know already, but I'd like (you)'re opinions.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

a1b27b  No.12311305

>>12311295

"POTUS was mean to us fraudsters, he told us to manufacture votes"

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

8d2e41  No.12311306

>>12311159

huomosplaination of how xi ping hurt the mis gendered demonrat or repugnant bad cop good cop neo con - all traitors

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

02c7ef  No.12311307

File: d1cde387d10c498⋯.png (1.11 MB, 640x960, 2:3, ClipboardImage.png)

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

91b08e  No.12311308

>>12311281

I have hope

Though a lot of people are watching the shadows, It's hard to think of any period in history where more people have escaped that cave worldwide.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

fd75bf  No.12311309

>>12311296

are there restrooms at DC city hall open to the public?

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

f5d86c  No.12311310

>>12311248

Can't wait for this revelation.

Bring it!

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

ea3c45  No.12311311

>>12311272

Been researching since oct 2017

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

9c9792  No.12311312

File: 808017b64f67e32⋯.png (114.73 KB, 216x282, 36:47, ClipboardImage.png)

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

193173  No.12311313

>>12311204

11,780 Q as the search :

https://www.questdiagnostics.com/home/physicians/testing-services/condition/genetics/

Genetic testing : Genetics - Quest Diagnostics

Search domain www.questdiagnostics.com/home/physicians/testing-services/condition/genetics/www.questdiagnostics.com/home/physicians/testing-services/condition/genetics/

QNatal® Advanced, an automated cfDNA noninvasive prenatal screening assay, demonstrates excellent performance characteristics, high positive predictive values, and very low "no-call" rates.Its validated technology delivers accurate results with clear positive or negative reporting for chromosomal abnormalities.

A Review of United States Air Force and Department of Defense Aerospace Propulsion Needs

https://www.nap.edu/read/11780/chapter/10

MyNAP members save 10% online.

Login or Register to save!

Rocket and air-breathing propulsion systems are the foundation on which planning for future aerospace systems rests. A Review of United States Air Force and Department of Defense Aerospace Propulsion Needs assesses the existing technical base in these areas and examines the future Air Force capabilities the base will be expected to support. This report also defines gaps and recommends where future warfighter capabilities not yet fully defined could be met by current science and technology development plans.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

b871f9  No.12311314

>>12311273

thx.

I hate wasting bread, but it seems rude not to reply.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

327bc8  No.12311315

File: 1c7d4d3a4c78914⋯.gif (78.95 KB, 500x70, 50:7, New_PDC.gif)

Hey Q, could we get a little of pic-related, for old times sake?

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

1894cf  No.12311316

>>12311132

https://spothero.com/washington-dc-parking

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

50fd09  No.12311317

File: bf60161137e6055⋯.jpg (48.57 KB, 465x262, 465:262, FAGS.jpg)

>>12311269

gay fags

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

b157a2  No.12311318

File: aa07020f76eaa27⋯.jpg (72.4 KB, 604x245, 604:245, ventilatorg.jpg)

Firing Squads

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

a1b27b  No.12311319

>>12311301

What game?

>>12311302

Pretty sure it is. After all, Stalin once said 2+2=4 yet he was also wrong about stuff.

It's possible as an option.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

2234b7  No.12311320

File: 7712d388cab13ed⋯.jpg (9.02 MB, 4262x2914, 2131:1457, jagan.jpg)

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

3bb08e  No.12311321

>>12311309

can always go "san francisco" style

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

c94518  No.12311322

>>12311297

>Muhjoo is not enough - never is.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

dcb9e0  No.12311323

File: 9c8918f0eb58ced⋯.mp3 (157.31 KB, 2021_01_04T17_27_39.mp3)

-******/////

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

193173  No.12311324

11,780 Q as the search

ZIP Codes(0.00 / 0 votes)Rate this definition:

11780

11780 is the US ZIP code of Nesconset, Head of the Harbor, St. James, Smithtown, Stony Brook, Nissequogue - New York

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

c6cd29  No.12311325

File: 89d9f4467f8c258⋯.gif (1.87 MB, 375x281, 375:281, 68747470733a2f2f73332e616d….gif)

>>12311308

big time,

using all those in th past to give us hindsight,

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

9a3f48  No.12311326

File: eb20e3f6989f382⋯.png (155.98 KB, 432x402, 72:67, ClipboardImage.png)

File: 9baa954507f454c⋯.png (127.3 KB, 395x349, 395:349, ClipboardImage.png)

>>12311225

Gonna be sunny and a high of 45 degrees. Patriotic "neck gaiters" or any type would be ideal as they'd keep you warm and you can just pull them up as "masks" if needed.

https://forecast.weather.gov/MapClick.php?lat=38.89&lon=-77.02#.X_MhGGjYrrc

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

a29ff6  No.12311327

>>12311309

>are there restrooms at DC city hall open to the public?

only for democrats (i.e., deviants, and antifa)

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

aee2a0  No.12311328

File: c07d8cbf13d20bc⋯.png (1.28 MB, 1658x1184, 829:592, Screen_Shot_2021_01_04_at_….png)

>>12311216

HER COUSIN WAS KIDNAPPED AND NEVER FOUND. SHE KNOWS that was a signal to her so not say anything. Malkin KNOWS about the trafficking. I am sure that was why they kidnapped her cousin

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

1e91c9  No.12311329

File: 69ac8c43734d006⋯.png (387.64 KB, 863x445, 863:445, ClipboardImage.png)

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

8d2e41  No.12311330

>>12311296

PISS ON THE BOW WOW BOWSER AND HER KHUNT BUFFALO COW BRAZILLE

AND PISS AND SHIT ON THE COPS PROTECTING THE TRAITORS

THAR FAR WORSE THAN THE TRAITORS

crying - 'oh give us respect, don't shoot us in the head…, - as they stand down for p00 p00 and let blm and antifa butt uck em in the arse

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

193173  No.12311331

>>12311324

11.780 Q as the search:

What does 11780 mean?

Definitions for 11780

11780

Here are all the possible meanings and translations of the word 11780.

Numerology

Chaldean Numerology

The numerical value of 11780 in Chaldean Numerology is: 0

Pythagorean Numerology

The numerical value of 11780 in Pythagorean Numerology is: 0

Images & Illustrations of 11780

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

a31a04  No.12311332

easiest classes to take when starting back in college after being gone for a while?

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

9cb40c  No.12311333

>>12311319

>What game?

Information warfare, anon.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

332f1b  No.12311334

File: 4f6babd17996655⋯.jpeg (314.05 KB, 640x828, 160:207, 4D13CBAC_5FE3_4ED3_9373_4….jpeg)

>>12311321

>can always go "san francisco" style

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

0cdb7d  No.12311335

>>12311230

Tyndal is a city in south dakota

tyndal afb is in florida?

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

c6cd29  No.12311336

File: 0ecd2502b92eaf8⋯.jpg (13.49 KB, 200x288, 25:36, Believers_dvd.jpg)

>>12311317

I take that as sarcasm,

you one my friends,

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

8bd541  No.12311337

>>12311246

Bingo..

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

3bb08e  No.12311338

>>12311319

5:5 anon misread previous

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

f56d94  No.12311339

>>12311315

kek - That one's near the top of the Best of Gifs Non-Titty division, Anon.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

a1b27b  No.12311340

>>12311333

Be more specific anon.

"Information warfare" is a given.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

07d1f1  No.12311341

File: c854e4994d83321⋯.jpg (69.17 KB, 500x697, 500:697, I_AM.jpg)

>>12311281

to escape a cave, you need light

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

f9d326  No.12311342

File: 5d1ff321f6441ea⋯.png (2.31 MB, 1125x2436, 375:812, 51149A19_E221_451B_A025_1D….png)

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

b291cb  No.12311343

File: 6f53d849dfed629⋯.png (504.5 KB, 729x410, 729:410, ClipboardImage.png)

File: 783cd341b77fc39⋯.png (16.51 KB, 78x101, 78:101, ClipboardImage.png)

Cuomo with a Pedo bracelet on?

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

dcb9e0  No.12311344

File: 1dbf7ec16eeb42d⋯.mp3 (157.31 KB, 2021_01_04T17_29_15.mp3)

*—-

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

4e68dd  No.12311345

File: 7b9ee671d9cff7d⋯.jpg (167.86 KB, 786x495, 262:165, freeman_facebook_instagram.jpg)

File: 05449d9d5181784⋯.jpg (87.92 KB, 640x346, 320:173, voter_fraud_georgia_blm.jpg)

Rigging elections, a family business.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

a1b27b  No.12311346

>>12311338

No worries, I do that all the time.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

631631  No.12311347

>>12311242

How many Christian people did you save under his watch, Anon?

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

841da3  No.12311348

My 14 year old and his friend just told me there is a school sponsored satanic club at school

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

17a2ff  No.12311349

File: a186a1cacf6774c⋯.jpeg (324.47 KB, 1618x1046, 809:523, FBDFA761_C1DB_4B44_9F5C_2….jpeg)

Pelosi had this creature with Covid travel to D.C to vote for her

https://twitter.com/breitbartnews/status/1346145805506392075?s=21

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

bbd3b3  No.12311350

Anon's… trying my best not to be a concernfag, but something has GOT to come out quick and with a huge boom. I've been around for over 2 years, red pilled I couldn't count how many over the years. I am holding strong in faith, but I'm seeing daily A LOT of people just jumping ship and saying "OH WELL, yeah he stole it, but what can we do about it." and just simply don't care. People are starting to to accept that Biden actually won, and it's disheartening. I'm in a HEAVILY red state and area as well. Just doesn't make sense.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

327bc8  No.12311351

>>12311339

Thx, had to throw that one together myself by hand

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

b157a2  No.12311352

>>12311332

start with Logic and maybe you'll get the last conservative instructor

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

393213  No.12311353

>>12311242

General as he was, I don't trust him.

But I'm gong to need a sauce on this

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

b291cb  No.12311354

File: 66289c7daa26fd3⋯.png (20.35 KB, 87x91, 87:91, ClipboardImage.png)

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

193173  No.12311355

>>12311204

11,780 Q as the search

ZIP Codes(0.00 / 0 votes)Rate this definition:

11780

11780 is the US ZIP code of Nesconset,

Head of the Harbor,

'''St. James, Smithtown,

Stony Brook, Nissequogue - New York

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

8d2e41  No.12311356

>>12311329

the only solution for misgendered is to have a lobotomy

no need to thank me for the solution, just go ahead with the procedure

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

f56d94  No.12311357

>>12311332

Gender Studies - just bring your hatred of White Men to class and you'll ace it.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

2c08a3  No.12311358

YouTube embed. Click thumbnail to play.

>>12311256

"…cook book"? See, that's a big mistake! The Bible could NOT have been constructed by human intellect…it's not possible! Scientific proof, ←– Right There!

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

dcb9e0  No.12311359

File: c4f310086f9b06a⋯.mp3 (134.06 KB, 2021_01_04T17_30_17.mp3)

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

c6cd29  No.12311360

File: 9202651fba87ab7⋯.jpg (128.59 KB, 638x479, 638:479, knights_templars_by_ngel_1….jpg)

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

65da4c  No.12311361

File: ae4f55be65fb544⋯.jpg (40.34 KB, 378x492, 63:82, Q_Natl_Guard_1178.JPG)

>>12311211

Snark aside

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

80e39c  No.12311362

File: a4e6eaf23e31f2a⋯.png (265.66 KB, 561x415, 561:415, ClipboardImage.png)

Mexico Offers Political Asylum to Julian Assange After UK Judge Blocks US Extradition

Mexico’s President Andres Manuel Lopez Obrador said during his daily press briefing that Mexico is prepared to offer political asylum to WikiLeaks founder Julian Assange.

The offer comes shortly after UK Judge Vanessa Baraitser denied an extradition request by the US government on the grounds that Assange would not be prevented from committing suicide in our prison system.

The US prosecutors have 14 days to appeal the judge’s decision and has said that they plan to do so.

“I’m satisfied that Mr. Assange has the intellect and determination to circumvent the suicide prevention measures, as Professor Kopelman posted, Mr. Assange would not only find a way to suicide, but he it will be executed with the single-minded determination of his ASD/Asperger’s,” the judge said in her ruling on Monday. “Facing conditions of mere total isolation, and without the protective factors which mitigate his risks at HMP Belmarsh, I am satisfied that the US procedures would not prevent Mr. Assange from committing suicide.

“For those reasons, I’ve decided that extradition would be oppressive by reason of Mr. Assange’s mental health and I order his discharge under section 91 of the extradition act 2003. The United States has 14 days to appeal,” the judge concluded.

President Obrador called for Assange to be released last January, to end his torture in detention.

“I don’t know if he has recognized that he acted against rules and norms of a political system, but at the time these cables demonstrated how the world system functions in its authoritarian nature,” Lopez Obrador said in response to a question about Assange at a regular government news briefing last year. “Hopefully consideration will be given to this, and he’s released and won’t continue to be tortured.”

Assange’s lawyers are attempting to get him released from prison now, despite the appeal window, and a bail hearing has been set for Wednesday.

https://www.thegatewaypundit.com/2021/01/breaking-mexico-offers-political-asylum-julian-assange-uk-judge-blocks-us-extradition-video/

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

50fd09  No.12311363

>>12311285

wonder if Jared's dad got a pardon so he could testify against him in court ?

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

3bb08e  No.12311364

File: 662680f085e37b4⋯.png (799.74 KB, 985x582, 985:582, Screen_Shot_2021_01_04_at_….png)

>>12311349

wtf is this?

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

c960aa  No.12311365

>>12311349

Man, her eyes look full of hatred.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

1e91c9  No.12311366

File: 372d4885f1249e9⋯.png (373.96 KB, 565x441, 565:441, shill_glowing.png)

>>12311242

"On his watch" ← tell tale sign of a shill

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

1c13b5  No.12311367

>>12311225

That is what I have done, and have only been told to pull it up twice. Once at a bank, and another time in a gift shop that I ended up being thrown out of anyway when they refused my disease-ridden cash and I told the woman she was crazy.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

193173  No.12311368

>>12311204

11.780 Q as the search:

What does 11780 mean?

Definitions for 11780

11780

Here are all the possible meanings and translations of the word 11780.

Numerology

Chaldean Numerology

The numerical value of 11780 in Chaldean Numerology is: 0

Pythagorean Numerology

The numerical value of 11780 in Pythagorean Numerology is: 0

Images & Illustrations of 11780

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

aee2a0  No.12311369

>>12311330

DC COPS are always dirty sacks of shit. that has never been a secret. dont be nice to them and dont try getting photo ops while there, because they are dirty fucking cops. all of them.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

f08cb6  No.12311370

>>12311335

The South Dakota Tyndall has two 'l's. My birth town. Population of about 200 farmers. No military base anywhere around. .

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

0170d6  No.12311371

DOW WAS DOWN ALMOST 800 POINTS TODAY

I WONDER WHAT HABBENS IF DEMOCRATS STEAL THE TWO SENATE SEATS TOMORROW??

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

f36e2d  No.12311372

YouTube embed. Click thumbnail to play.
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

8d25df  No.12311373

>>12311362

>Mexico Offers Political Asylum to Julian Assange After UK Judge Blocks US Extradition

notable in last bread

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

11bbac  No.12311374

File: 258c4ccb434c461⋯.png (61.13 KB, 528x545, 528:545, Screenshot_from_2021_01_04….png)

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

9cb40c  No.12311375

>>12311281

Having the same observances since the start of COVID. It really fucked a lot of people's heads up, and @POTUS' "self-disccovery" and "Q" operation hasn't penetrated the public psyche enough. It's done a very good job, but it needs some real mainstream pushes to get people to buy it all.

This isn't going to end in the next 4 years until something very public and convincing happens. That isn't going to happen until backchannels are no longer necessary.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

193173  No.12311376

>>12311204

11,780 Q as the search:

https://www.viator.com/tours/Mornington-Peninsula/2-hour-Snorkel-with-the-Seals/d22999-11780P9

'2 hour Snorkel with the Seals

3 Reviews

|

Sorrento, Australia

Share

from $62.64

Lowest Price Guarantee

Select Date and Travelers

Saturday, Jan 9, 2021

Number of travelers

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

d7bddf  No.12311377

the biggest problem we face and will always face is the ministry of truth (mainstream news). my trump supporting relative, who for whatever reason watches nbc, is now wishing he would just shut up and let biden transition. no matter how much you try to explain to them without going too far down the rabbit hole, they don't care. the news cycle is constantly beating into your head "president elect biden's victory", "trumps disgraced loss", "debunked conspiracy theories about voting fraud", "baseless claims about vote rigging".

it will be some twilight zone shit if/when the news ever reports the truth when it starts to come out.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

80e39c  No.12311378

File: 23d4ec81cf51ac2⋯.png (285.13 KB, 574x582, 287:291, ClipboardImage.png)

Project Veritas: Warnock Staff Admits Candidate’s Bias Against Police, “Police Officers Are Not All Good…Most of Them Are Bad, WE Know That”

O’Keefe strikes again!

Project Veritas released undercover video of Raphael Warnock’s staff admitting the Democrat Senate candidate’s bias against the police.

The Georgia twin senate runoff election takes place Tuesday, January 5th and the stakes could not be higher.

The Democrats are currently trying to steal both Georgia Senate seats in order to install radical leftists and take control of the Senate.

Georgia Democrat Senate candidate Raphael Warnock is a dangerous Marxist.

“Police officers are not all good, you know what I’m saying? Most of them are bad, WE know that,” Raphael Warnock’s campaign staffer Sasha Williams is heard saying on undercover audio.

Another campaign staffer said Warnock avoids using the phrase ‘defunding the police’ so he doesn’t get attacked, but his goal really is to defund the police.

“He avoids using defunding the police…in reality his whole platform is along the lines of the same people saying defund the police,” another staffer admits to Project Veritas.

WATCH:

https://www.thegatewaypundit.com/2021/01/project-veritas-warnock-staff-admits-candidates-bias-police-police-officers-not-good-bad-know-video/

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

c7ba80  No.12311379

File: 09b2cb1bdaf8768⋯.png (56.12 KB, 596x575, 596:575, lin.PNG)

File: 07f31ea9c26d98c⋯.png (641.01 KB, 813x612, 271:204, road.PNG)

File: 95ba7ecbc5ab6ee⋯.png (643.66 KB, 777x578, 777:578, 5_13.PNG)

File: 9bfee8ef046a4b5⋯.png (682.32 KB, 785x1024, 785:1024, image_164_785x1024.png)

Revisiting the Kappy Rabbit Hole…….

Isaac Kappy called out Tom Hanks of being a pedophile (Also see: @SaRaAshcraft). This blew up on the internet and even hit some mainstream news outlets…

Hanks never responded, but we all know about his creepy glove pics on Insta.

One specific post showed a picture of a glove with the caption reading:

'Historic Route 66. Roadkill? I hope not! Hanx.'

Dated April 4, 2019 - 39 days before Kappy's death……on Route 66.

Isaac Kappy "jumped" from an overpass on ROUTE 66 near Bellemont, Arizona on May 13, 2019.

The SAME day Kappy "jumped" Hanks posted the red handkerchief pic to his Insta…

A red handkerchief. Within the world of high profile occult murders/suicides, there is the ever-present theme of the “red scarf.”

High profile people are found hanged, often with red scarves, including Kate Spade and L’Ren Scott.

Coincidence it's the SAME day as Kappy's death?

Did you know that the person who hit Kappy's body was named Forest Scott Proctor. (Police Report attached as pic)

Forest???

Like, Forrest (Gump)?? On Route 66???

COINCIDENCE???

THREAD: https://twitter.com/Jhomes551/status/1346140916168404993

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

7c4441  No.12311380

File: 492b2cbf7081296⋯.jpeg (322.29 KB, 640x845, 128:169, 313829BC_241D_4F25_8901_A….jpeg)

>>12311371

>DOW WAS DOWN ALMOST 800 POINTS TODAY

>I WONDER WHAT HABBENS IF DEMOCRATS STEAL THE TWO SENATE SEATS TOMORROW??

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

24f8ea  No.12311381

>>12308395 (pb)

>>12309896 (pb)

There is a particular dimwitten anon here that completely misunderstood my earlier post here.

I never said that footage like this does not exist.

I said learn to use your brain and exercise discernment.

Until yesterday I would have guessed LW's sauce must be solid, trust Lin. Why else would he say something like that.

But now Lin says that origin of the sauce is lizard squad, people who were convicted in the past and possibly offered leniency in return for becoming assets for our three letter agencies.

Sauce like this is either released by white hats or black hats, nothing else makes sense to me, since information like this will be well guarded. So either white hats used lizard squad -> Kappy -> LW as a vector to get it out or black hats did. In the second instance it would serve as a means to muddy the waters and introduce fake footage to discredit the real footage.

If you ask me which alternative is most likely, today I tend to chose the latter, yesterday I would have guessed the first.

Credibility is everything in information warefare, I rather exercise caution in this case.

I used to get shit from anons for pointing out that the narrative LW points out seems to be correct even if little details might be wrong (for instance whether JR's children were adopted from Wales vs. Ireland), but now I absolutely urge anons to stay extra skeptical because if all of a sudden clips emerge and it turns out they are fake, it's going to be hard to later introduce the real evidence and convince the public that this is really going on.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

01634b  No.12311382

File: 88dbe69e9671bbe⋯.png (594 KB, 1326x878, 663:439, 88dbe69e9671bbede0ef44a8cc….png)

In God we trust. Amen.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

4c76f7  No.12311383

>>12311314

Pretty sure it's only wasted when shills do it.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

1894cf  No.12311384

>>12311349

We don't have to mail our votes anymore, since it is safe enough for them!!

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

1e91c9  No.12311385

File: 308f80483b6047b⋯.jpg (105.3 KB, 577x432, 577:432, biker1.jpg)

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

8169a2  No.12311386

>>12310905

I'm beginning to think one of the purposed for Wood's tweets is to lure out the ones having pretended to be "white hats".

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

c960aa  No.12311387

>>12311350

>not to concernfag but

Proceeds to concernfag

Big brain move right there

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

0cdb7d  No.12311388

>>12311370

whats underground there I wonder

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

c6cd29  No.12311389

File: 33adb165a8f3ffd⋯.jpg (108.72 KB, 720x720, 1:1, 12189937_1489514101377965_….jpg)

>>12311358

Yehuda ain't so weak that he can't

manipulate a human's ways or words,

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

193173  No.12311390

>>12311204

11,780 Q as the search:

https://www.almexperts.com/images/Photoweb/140991_11780_11G_25085_ResumePath.pdf

RONALD G. QUINTERO, CPA, CFA, ABV, CDBV, CFE,

CFF, CIRA, CMA, CTP

Managing Director • Chartered Capital Advisers, Inc.

245 Park Avenue, 39th Floor • New York, NY 10167

(212) 327-0200 • (212) 327-0225 FAX • q@charteredcapital.com

www.charteredcapital.com

Professional Activities

 Served more than 750 public and private clients

of all sizes in a broad range of industries

Areas of Expertise

 Valuations of businesses, financial instruments, and

intangible assets

Italian Holiday Voucher Boosted Domestic Tourism | .TR

Search domain www.tourism-review.com/holiday-voucher-boosted-domestic-tourism-in-italy-news11780https://www.tourism-review.com/holiday-voucher-boosted-domestic-tourism-in-italy-news11780

Domestic tourism supported by holiday voucher in Italy. In a summer that has been further from typical due to the coronavirus pandemic, Italy has been able to boost domestic demand in an effort to offset the drop in international arrivals.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

8169a2  No.12311391

>>12311386

meant "purposes"

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

99d200  No.12311392

File: 778aa853ede953b⋯.mp4 (14.94 MB, 480x360, 4:3, Q_Fighting_Evil.mp4)

>>12310788

Thank You Baker!

o7

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

e4ff8c  No.12311393

>>12310159 lb

Is the hacked Comet Ping Pong menu real?

Legitimate sauce for it?

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

1ed846  No.12311394

File: 4e38e81eb92f0a2⋯.png (436.95 KB, 535x610, 107:122, Screenshot_2021_01_04_MFA_….png)

OTD

Crossed swords

in 1878 the

Flag of Russia

Russian Army liberated #Sophia

Flag of Bulgaria

from #Ottoman troops.

The citizens of the #Bulgarian capital met #Russians with enthusiasm. The liberation of Sophia brought the #Slavic nations closer to the long-sought freedom from the Ottoman yoke

https://twitter.com/mfa_russia/status/1346072515303657472

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

e1d914  No.12311395

File: e02181d8a4721f2⋯.png (69.81 KB, 574x1250, 287:625, ClipboardImage.png)

Night Shift work.

Asking for moar names.

Good or Bad?

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

4b1a9a  No.12311396

The covid lockdowns were to condition normies, and put everything in place, for the martial law that will be needed when half of Congress is arrested; yes or no?

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

2fbba3  No.12311397

YouTube embed. Click thumbnail to play.

Deep fakes just mentioned on the floor of the House

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

aee2a0  No.12311398

>>12311274

or right about Jared. have we not learned anything from the jew shill, we do know that there is no denying that they stick together in the destruction of the "goy" of that I am sure. I HOPE she is wrong about Kushner. I do try to like him and the more I watch his interviews, I think I do like him.

but still. be cautious

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

f56d94  No.12311399

>>12311350

> A LOT of people just jumping ship and saying "OH WELL, yeah he stole it, but what can we do about it."

BLACKPILL: many such cases

I'm experiencing the same thing, Anon.

The Precipice is super narrow af at this point - something has to break soon.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

42e15f  No.12311400

>>12311348

What state anon? Did the same in my area. My bro is a pastor went to the school and used this as a pretense to set up a Christian club. Eventually the satan club was BTFO. Christian club remains.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

299b63  No.12311401

>>12311349

>>12311364

NPC escapee from DOOM v1.21

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

a3f4a4  No.12311402

File: 90b43d7205e85fe⋯.png (154.01 KB, 2442x1152, 407:192, Kilt_Day.png)

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

a29ff6  No.12311403

File: 11cb78c68f6275b⋯.png (1.04 MB, 898x1043, 898:1043, ClipboardImage.png)

File: 4cfab5f46913a6a⋯.png (5.88 MB, 3814x1948, 1907:974, ClipboardImage.png)

BREAKING: Mexico Offers Political Asylum to Julian Assange After UK Judge Blocks US Extradition (VIDEO)

https://www.thegatewaypundit.com/2021/01/breaking-mexico-offers-political-asylum-julian-assange-uk-judge-blocks-us-extradition-video

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

3bb08e  No.12311404

>>12311379

k. so.

if the death of that young man who worked for Loefller was a hit, isn't Wood concerned?

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

393213  No.12311405

>>12311362

Trump's biggest stain was not pardoning this fellow.

disgusting.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

193173  No.12311406

>>12311204

11,780 Q as the search:

https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=PRK11780

Conserved Protein Domain Family

PRK11780

Entrez CDD Structure Protein Help

COVID-19 is an emerging, rapidly evolving situation.

Get the latest public health information from CDC: https://www.coronavirus.gov

Get the latest research information from NIH: https://www.nih.gov/coronavirus

Find NCBI SARS-CoV-2 literature, sequence, and clinical content: https://www.ncbi.nlm.nih.gov/sars-cov-2/

?

PRK11780: PRK11780 Download alignment

isoprenoid biosynthesis glyoxalase ElbB

Links?

Source: PRK

Taxonomy: Bacteria

Protein: Representatives

Specific Protein

Related Protein

Related Structure

Architectures

Superfamily: cl00020

Statistics?

Structure?

PRK11780 is a member of the superfamily cl00020.

Sequence Alignment

include consensus sequence ?

Format:

Hypertext

Row Display:

up to 10

Color Bits:

2.0 bit

Type Selection:

the most diverse members

225630924 11 KLKAAVVLSGCGHLDGVEVREAVLSLLVLDQQEVDVKCFAPDINITQVMNHRTKEATK-EK-RNVLVEAARIARGEIYDL 88

299768483 1 MKKVAVILSGCGYLDGSEIRESVLTLLALDTANIEYQIFAPDEPLFHVIDHVSGEINMtER-RNILQEAGRIARGEIFSL 79

126643263 1 -----------–MtER-RNILQEAGRIARGKISSL 22

184159767 1 MKKVAVILSGCGYLDGSEIRESVLTLLALDTVNIEYQIFAPDEPLFHVIDHVSGEINMtER-RNILQEAGRIARGKISSL 79

269958346 1 -MNCAVLLSGCGHMDGSEIRESVLVLLELDRLGVRFQCCAPDIQQCDVVNHVSKSSES-QTaRNILVESARIARGDIVNI 78

56417264 1 -MNCVVLLCGCGHMDGSEVRESVLVLLELDRLGVKFQCCAPDIQQHDVVNHASKSTEN-QT-RNILAESARIARGEVISI 77

222475628 1 -MNCVVLLCGCGHMDGSEVRESVLVLLELDRLGVKFQCCAPDIQQHDVVNHASKSTEN-QT-RNILAESARIARGEVISI 77

88606844 1 -MNCAVLLCGCGHMDGSEIREAVLALLALDSYGINVTCCAPNIKQVDVVDHLSGSTLE-EE-RDIMSESARIARGNVVDP 77

42522181 1 MKKIAVVLSGCGHRDGSEITESVSLLIGLHQAGAEVHCFAPDI-QIPITNHINGEAQG-EK-RSLLTEAARIARGHIQSL 77

239617221 1 -MKAGILLSGCGLGDGTQIEEVMLTYLSLDKYGIDYITFAPNEMQHDVIDHYTEKPQN-EK-RNILIESARIGRGKICDI 77

225630924 89 KEAKAENFDMLVVPGGYGVAKNLSDLAESKDMVTVMPEFERLVSEFFVTKKPIGAICISPAIIVSILsskigkeE-SKVK 167

299768483 80 NQLNENEFDGLLLPGGFGVAKNLSTFAFKGAEARVHSTVASILKAFHQSKKPIGAICISPALLALTF-–GdLHPN 152

126643263 23 DQLNENEFDGLILPGGFGVAKNLSTFAFKGAEARVHGTVASILKAFHQSKKPIGAICISPALLALTF-–GeLHPT 95

184159767 80 DQLNENEFDGLILPGGFGVAKNLSTFAFKGAEARVHGTVASILKAFHQSKKPIGAICISPALLALTFg-eL–HPT 152

269958346 79 KSLRVHEFDMLIVPGGFGVAKNFSNLVSQSGSVVVEDDVNSLIREFHRVRKAIGGVCIAPAIIAAALs--ElVKVK 152

56417264 78 ERVQVHEFDMLIVPGGFGVAKNFSNLVSQSGPVSVIDSVKGLIHQFHRARKAIGGVCIAPAVIAAALs--ElVKVK 151

222475628 78 ERVQVHEFDMLIVPGGFGVAKNFSNLVSQSGPVSVIDSVKGLIHQFHRARKAIGGVCIAPAVIAAALs--ElVKVK 151

88606844 78 KDISPNDFDMLILPGGFGVAKNYSDILKGESPVSVLEEVKQTIVKFHKEKKAIGAICIAPAIVAASLs--SvSKVK 151

42522181 78 DKLHAKDFDAVVFPGGYGAAKNLSNWAEKGAQCEVNPDVKRVILEFHSASKPIGALCIAPVLVAKVLg-dK–KVT 150

239617221 78 REVSCKDIDAIIIPGGLGVFKNLSTFIVDKKSFTVNKNVDDLLKAMYLSKKSIAGICGAVILIAKSLs-qH–VSD 150

225630924 168 VTIG—DDREQLIERLGGEHIKCDTELSIEDEEHNVFSCSAYMRSDeST-YSVYQGIKHMIDSMVKKI 232

299768483 153 ITLGs-dVNTAKEIEKTGSIPHVCQTSSCVVDKQNLFVTTPAYMDDQaGL-KDVFLGITSLVTAMTILA 219

126643263 96 ITLGs-dLNIAKEIEKTGSIHHVCQTSDCVVDKQNLFVTTPAYMDDQaNL-KDIYTGITSLVNTMTALA 162

184159767 153 ITLGs-dLNIAKEIEKTGSIHHVCQTSSCVVDKQNLFVTTPAYMDDQaNL-KDIYAGITSLVNTMTALA 219

269958346 153 VTLG—DDTDGIISRCGGEHVVCPTDGFVVDEENAVFSCSAYMRDD-RL-HRVHLGIQKMVEGMVKFC 216

56417264 152 VTLG—DDADGIISRCGGEHVVCPTDDFVADEKNAVFSCSAYMRDD-TL-HRVHLGIQKMVEGMVKFC 215

222475628 152 VTLG—DDADGIISRCGGEHVVCPTDDFVADEKNAVFSCSAYMRDD-TL-HRVHLGIQKMVEGMVKFC 215

88606844 152 VTLG—EDIDSIISRCGGEHVFCETDDYVADIDMGVFSTPAYMRKD-SL-HKIHVGIHKMVGAMVDFV 215

42522181 151 VTIGd-dAATAAEIEKTGAIHEECPVNDYITDRESKVVTTPAYMYGD-AKpNEVFAGIFGLAHEIVEWA 217

239617221 151 LKVAtanDAYGELLSELNVNAVNCSAKECVIDRKKQSSNYP-RI—SGIQKNGRNYGGY- 206

Citing CDD

Lu S et al.(2020). "CDD/SPARCLE: the conserved domain database in 2020.", Nucleic Acids Res. 48(D1):D265-D268.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

f08cb6  No.12311407

>>12311230

Used to be a shitload of Cold War nuclear missile silos in the Tyndall, SD area. Most were emptied out and bought by locals for groovy homes.

There is NOTHING around Tyndall but cornfields and occasional farmhouses.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

65f0b3  No.12311408

>>12311242

You do realize everyone is just filtering you, right?

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

c6cd29  No.12311409

File: 17db1f694b63c0b⋯.jpg (9.84 KB, 269x187, 269:187, imagesggg.jpg)

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

b157a2  No.12311410

File: ced0a3b44dd86b3⋯.jpg (216.16 KB, 1200x865, 240:173, cannibalism.jpg)

>>12311379

Red scarf goes way back

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

80e39c  No.12311411

File: 50402aa3ea0a301⋯.png (419.7 KB, 903x895, 903:895, ClipboardImage.png)

Congress Approves Rules Regulating Jan. 6 Electoral Vote Count

The House of Representatives and the Senate on Sunday adopted rules that outline how the counting of Electoral College votes will take place on Jan. 6.

The rules were passed without recorded votes. Instead, a voice vote was used in both chambers.

The guidance, introduced by Senate Majority Leader Mitch McConnell (R-Ky.), says the chambers will meet in a joint session on Jan. 6 presided over by Vice President Mike Pence.

Pence, as president of the Senate, will open “all the certificates and papers purporting to be certificates of the electoral votes,” the rules state, a nod to how seven states sent so-called competing electors, or certificates for both Democratic presidential nominee Joe Biden and President Donald Trump, to Washington.

The certificates and papers will be opened, presented, and acted upon in alphabetical order, starting with Alabama.

This is when dozens of Republicans—50 representatives and 12 senators, according to an Epoch Times tally—are planning to object to some certificates, alleging election irregularities including voter fraud and failure to follow state election laws.

That will trigger a withdrawal from the joint session and a two-hour debate, followed by votes in each chamber. Only with a majority vote from both the House and the Senate would a challenge be upheld, which even supporters find unlikely, considering Democrats who control the House and Senate Republican leadership, including McConnell, have expressed disapproval with the plan to object.

House Speaker Nancy Pelosi (D-Calif.) in a letter to colleagues on Sunday noted that objections can happen but said, at the end of the day, Biden “will be officially declared the next president.”

“On Monday, we will have a clearer picture of how many state votes will be subject to an objection. Our choice is not to use the forum to debate the presidency of Donald Trump,” she added.

Reps. Ron Estes (R-Kan.), Tracey Mann (R-Kan.), and Jacob LaTurner (R-Kan.) said Sunday they will join in the objections, saying in a statement that several states are “facing serious allegations of voter fraud and violations of their own state law.”

“This action is not taken lightly and comes after extensive study and research. Kansans deserve to know that all legal, and only legal, votes were counted. We hope our actions begin to restore the confidence of tens of millions of our fellow Americans that feel their sacred right to vote is under attack,” they added.

Reps. Jim Jordan (R-Ohio) and Richard Hudson (R-N.C.) also announced Sunday they’ll object.

https://www.theepochtimes.com/congress-approves-rules-regulating-jan-6-electoral-vote-count_3642381.html

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

748849  No.12311412

File: 1bbe17163250931⋯.png (102.57 KB, 576x583, 576:583, Screenshots_2021_01_04_09_….png)

>>12311300

Infiltration at the highest levels of government, media, science, health,military CoC

Newfags think they're smart but they ain't

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

0ddfc2  No.12311413

>>12311349

That thing has more testosterone than the whole shiff clan combined.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

cd252c  No.12311414

File: 99ef4fb419f30ce⋯.png (833.26 KB, 1178x626, 589:313, ClipboardImage.png)

Q-day 1165 (6+5=11)… 11:11

1-4 (four 1's)… 11:11

2021 (four 1's)… 11:11

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

a29ff6  No.12311415

>>12311402

it's WED but you're on a roll

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

83a1be  No.12311416

File: e132c18ec03c4aa⋯.png (12.15 KB, 406x355, 406:355, ClipboardImage.png)

File: d8013a29f57f515⋯.png (324.56 KB, 2048x2048, 1:1, K3K_sh3_S3D_LoveNOT_d3d.png)

File: 21ab7a7d74e6d85⋯.jpg (227.53 KB, 887x500, 887:500, Now_questions_from_COMMIES….jpg)

File: 4819d02e18df3f0⋯.jpg (515.38 KB, 2400x1400, 12:7, Q_palindrome_Q.jpg)

File: 7cd6f8b5c395d0e⋯.png (45.18 KB, 455x480, 91:96, SAVES_incre_MENTAL_backUP.png)

>>12311321

>go "san francisco" style

PAL-in-DROME

[123] 11 [321]

6 2 6

QDrop# 626 (14) (5)

01/27/2018 12:34:38

Chatter exploding.

Change of narrative will be required.

[-4][-5]

Public to awaken [mass-start].

Sleeping pill reject.

OP Mockingbird FAILURE.

FAKE>REAL.

BLIND>20/20.

KILL_CHAIN.

Where we go one, we go ALL>

Q

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

beff4d  No.12311417

>>12311132

Anon has heard that it's better to park and ride from VA or MD.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

4b1a9a  No.12311418

>>12311394

They went from one yoke to another

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

1eb496  No.12311419

File: 5ea198a9ad31018⋯.jpg (126.59 KB, 500x469, 500:469, ace_2.jpg)

File: b3beea2ddd27cea⋯.jpg (1.64 MB, 4032x3024, 4:3, IMG_0431.jpg)

File: 30bdc87da34079e⋯.jpg (1.63 MB, 4032x3024, 4:3, IMG_0432.jpg)

File: b2c60adc4d5fcac⋯.jpg (403.46 KB, 1123x842, 1123:842, 271_3R.jpg)

File: ebe15f22b017978⋯.jpg (146.24 KB, 500x525, 20:21, ace_4.jpg)

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

b0799f  No.12311420

File: ff2c5e90616dc41⋯.jpg (12.4 KB, 255x187, 15:11, brrrrrrrrrrt.jpg)

Oct 21 2020

4930

Q !!Hs1Jq13jV6 ID: 996755 No.11203025 📁

Oct 21 2020 21:48:02 (EST)

https://www.fbi.gov/about/leadership-and-structure/fbi-executives/kohler📁

Q

4929

Q !!Hs1Jq13jV6 ID: 996755 No.11202919 📁

Oct 21 2020 21:45:15 (EST)

https://www.fbi.gov/about/leadership-and-structure/fbi-executives/tyson📁

Q

4928

Q !!Hs1Jq13jV6 ID: 996755 No.11202817 📁

Oct 21 2020 21:42:46 (EST)

Bishop.jpg⬇

4927

Q !!Hs1Jq13jV6 ID: 996755 No.11202692 📁

Oct 21 2020 21:40:02 (EST)

David_Bowdich.jpg⬇

4926

Q !!Hs1Jq13jV6 ID: 996755 No.11202551 📁

Oct 21 2020 21:36:32 (EST)

Haspel.jpg⬇

Non_CIA_background next?

Q

4925

Q !!Hs1Jq13jV6 ID: 996755 No.11202412 📁

Oct 21 2020 21:32:59 (EST)

EdWDTBXVcAAwnm0.png⬇

4924

Q !!Hs1Jq13jV6 ID: 292db4 No.11202027 📁

Oct 21 2020 21:21:53 (EST)

BOOMS EN_ROUTE TOMORROW.

This is not a drill.

Q

4923

Q !!Hs1Jq13jV6 ID: 12e944 No.11201288 📁

Oct 21 2020 20:55:05 (EST)

https://twitter.com/VRSVirginia/status/1319071346282778624📁

Dearest Virginia -

We stand with you.

Now and always.

Find peace through prayer.

Never give up the good fight.

God bless you.

Q

4922

Q !!Hs1Jq13jV6 ID: 7769ae No.11200840 📁

Oct 21 2020 20:32:00 (EST)

https://www.foxnews.com/politics/laptop-hunter-biden-linked-fbi-money-laundering-probe📁

Q

4921

Q !!Hs1Jq13jV6 ID: 7769ae No.11200116 📁

Oct 21 2020 19:58:40 (EST)

Ek4G8urXIAEKasf.jpg⬇

4920

Q !!Hs1Jq13jV6 ID: 7769ae No.11200113 📁

Oct 21 2020 19:58:24 (EST)

Do you remember when #MeToo lost all credibility when they refused to support Tara Reade coming forward re: claims of sexual assault by Joe Biden?

Political movement?

Q

4919

Q !!Hs1Jq13jV6 ID: fb3dc6 No.11199550 📁

Oct 21 2020 19:31:51 (EST)

https://twitter.com/WarRoomPandemic/status/1319022578002964485📁

Client?

Political pundit [pollster] for sale?

Do you see how it works?

ENEMY OF THE PEOPLE.

Q

4918

Q !!Hs1Jq13jV6 ID: 724ac8 No.11197253 📁

Oct 21 2020 17:43:55 (EST)

EMAqDm9UUAE3wDQ.png⬇

ELT3m8uXYAAWTPV.jpg⬇

4917

Q !!Hs1Jq13jV6 ID: a48b57 No.11193377 📁

Oct 21 2020 14:06:39 (EST)

https://twitter.com/ChanelRion/status/1318931828481400833📁

Underage family member?

FBI can no longer attempt to shelter [protect] the Biden's?

Public awareness kills all protections.

Q

4916

Q !!Hs1Jq13jV6 ID: a48b57 No.11193181 📁

Oct 21 2020 14:01:21 (EST)

https://nypost.com/2020/02/03/joe-biden-kisses-granddaughter-on-lips-during-iowa-rally/📁

Inappropriate [sick] to you?

Normal to them?

Dark secrets.

Q

4915

Q !!Hs1Jq13jV6 ID: a48b57 No.11193040 📁

Oct 21 2020 13:56:57 (EST)

A deep dark world is being exposed.

The truth won't be for everyone.

Have faith in Humanity.

Q

4914

Q !!Hs1Jq13jV6 ID: a95dd3 No.11192967 📁

Oct 21 2020 13:54:01 (EST)

Dkrr0VeXgAArTN3.jpg⬇

4913

Q !!Hs1Jq13jV6 ID: a95dd3 No.11192896 📁

Oct 21 2020 13:52:14 (EST)

EJ380AEUcAAfI_w.jpg⬇

4912

Q !!Hs1Jq13jV6 ID: a95dd3 No.11192872 📁

Oct 21 2020 13:51:40 (EST)

D0MMzlYX4AEDm_u.jpg⬇

4911

Q !!Hs1Jq13jV6 ID: a95dd3 No.11192741 📁

Oct 21 2020 13:48:03 (EST)

7ey66blhcww31.jpg⬇

4910

Q !!Hs1Jq13jV6 ID: a95dd3 No.11192736 📁

Oct 21 2020 13:47:34 (EST)

Anonymous ID: 4e0898 No.11192597 📁

Oct 21 2020 13:43:52 (EST)

>>11192505

So many people refuse still to admit the evils in the world. They're going to need to see a lot more.

>>11192597

Freedom of information [truth] = END

Q

4909

Q !!Hs1Jq13jV6 ID: a95dd3 No.11192602 📁

Oct 21 2020 13:43:55 (EST)

democrat_party_crumbling_held_up_by_cnn_msnbc_cbs_nyt.jpg⬇

4908

Q !!Hs1Jq13jV6 ID: a95dd3 No.11192505 📁

Oct 21 2020 13:41:31 (EST)

The_Great_Awakening_Crowd_Meme_570x350.jpg⬇

Sometimes you can't TELL the public the truth.

YOU MUST SHOW THEM.

ONLY THEN WILL PEOPLE FIND THE WILL TO CHANGE.

Crimes against children unite all humanity [cross party lines]?

Difficult truths.

Q

Lin Wood

@LLinWood

·

10h

I believe Chief Justice John Roberts & a multitude of powerful individuals worldwide are being blackmailed in a horrendous scheme involving rape & murder of children captured on videotape.

I have the key to the files containing the videos. I have also shared this information.

https://mobile.twitter.com/LLinWood/status/1345991175690457091

Get it yet?

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

9cb40c  No.12311421

>>12311404

I don't know, is he? Was the hit against that kid, or someone close to him?

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

193173  No.12311422

>>12311204

WHAT IS THIS?

COMES UP WHEN SEARCHING 11,780 Q

https://pubs.acs.org/doi/10.1021/ja204289q

ACS is committed to helping combat the global COVID-19 pandemic with initiatives and free resources. Learn More

From Highly Enantioselective Catalytic Reaction of 1,3-Diynes with Aldehydes to Facile Asymmetric Synthesis of Polycyclic Compounds

Mark Turlington, Yuhao Du, Samuel G. Ostrum, Vishaka Santosh, Kathryne Wren, Tony Lin, Michal Sabat, and Lin Pu*

View Author Information

Cite this: J. Am. Chem. Soc. 2011, 133, 30, 11780–11794

Publication Date:June 20, 2011

https://doi.org/10.1021/ja204289q

Copyright © 2011 American Chemical Society

RIGHTS & PERMISSIONS

Abstract

Abstract Image

(S)-1,1′-Binaphth-2-ol (BINOL) in combination with ZnEt2, Ti(OiPr)4, and biscyclohexylamine was found to catalyze the highly enantioselective (83–95% ee) addition of various 1,3-diynes to aldehydes of diverse structures. This method provides a convenient pathway to generate a number of optically active dienediynes as the acyclic precursors to polycyclic compounds. The chiral dienediynes undergo highly chemoselective Pauson–Khand (PK) cycloaddition in benzaldehyde by using [Rh(cod)Cl]2 as the catalyst in the presence of rac-BINAP. High diastereoselectivity (up to >20:1) has also been achieved with the chiral dienediyne substrates containing a bulky substituent adjacent to the chiral center. In the presence of the Grubbs II catalyst, ring-closing enyne metathesis of the PK cycloaddition products led to the formation of the desired 5,5,7- and 5,5,8-fused tricyclic compounds. Further highly diastereoselective Diels–Alder reaction of a 5,5,7-tricyclic compound with maleic anhydride produced a 5,5,7,6-polycyclic product. The asymmetric synthesis of polycyclic compounds from optically active dienediynes has established a novel and efficient synthetic route to the structural framework of many biologically significant molecules.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

782bef  No.12311423

make yourslef heard at DOJ.

Report election crime using the proof you know about. Yes they know we know, and we know that they know, but maybe flooding them will get the point across.

https://www.justice.gov/actioncenter/report-crime

Or write the DOJ ( not report a crime) and tell them to investigate the voter fraud seriously instead of dismissing it.

https://www.justice.gov/contact-us

Or call them.

Home

Contact the Department

Messages to the Department of Justice, including the Attorney General, may be sent using this form. Your message will be forwarded to the responsible Department of Justice component for appropriate handling.

Contact Us Form

Other Correspondence

Correspondence to the Department, including the Attorney General, may be sent to:

U.S. Department of Justice

950 Pennsylvania Avenue, NW

Washington, DC 20530-0001

The Department may be contacted by phone at the following:

Department Comment Line: 202-353-1555

Department of Justice Main Switchboard: 202-514-2000

TTY/ASCII/TDD: 800-877-8339 (or Federal IP Relay Service)

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

3bb08e  No.12311424

File: 99c44bf65b22fe9⋯.png (877.5 KB, 1079x681, 1079:681, kek_copy_3.png)

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

80e39c  No.12311425

Israeli PM Netanyahu claims Iran's uranium enrichment to 20 percent is bid to develop nukes

Prime Minister of Israel Benjamin Netanyahu has accused Iran of working to develop nuclear weapons, after Tehran claimed on Monday that it has resumed uranium enrichment to the 20-percent level at its Fordo site.

"Iran's decision to continue violating its commitments, to increase the level of enrichment and advance its abilities to enrich uranium underground cannot be explained in any way other than the continued implementation of its intention to develop a military nuclear program," Netanyahu said in a statement.

A spokesperson for the Iranian government, Ali Rabiei, told the Mehr News Agency on Monday that Tehran was pursuing uranium enrichment to a purity of 20 percent, which is lower than the 90 percent weapons-grade level, but is still a breach of the 2015 JCPOA nuclear deal.

Last month President Hassan Rouhani accused of Israel of being behind the assassination of top Iranian nuclear scientist Mohsen Fakhrizadeh, who was killed in late November 175 kilometers from Tehran.

Earlier in November, Netanyahu had warned against Iran's nuclear program, urging against any return to the nuclear deal abandoned by US President Trump in 2018, and instead calling for an "uncompromising policy to ensure that Iran does not develop nuclear weapons."

The Israeli PM has previously given elaborate presentations on what he said is Iran's secret "nuclear weapons development site" at Abadeh in the south of the country.

https://www.rt.com/news/511487-netanyahu-iran-enrichment-nuclear-weapons/

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

62d21b  No.12311426

>>12310888

He’s certainly not getting one from you.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

425134  No.12311427

File: 4e5f6017b68f864⋯.jpeg (381.17 KB, 640x899, 640:899, 8EB88DB1_7EBF_4B4A_BDB0_1….jpeg)

>>12311321

>can always go "san francisco" style

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

a29ff6  No.12311428

>>12311412

just proves you don't have a fucking clue, cunt.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

393213  No.12311429

>>12311371

IF?

they will steal them and stocks (eventually) will have a blow-off top until the $ collapses.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

a1b27b  No.12311430

File: 3ab09c85a5cd348⋯.png (480.78 KB, 692x371, 692:371, ObamaIsSatanic.png)

>>12311369

Most cops are GOOD PEOPLE.

Your post is consistent with fomenting Democrat narrative of anti-police.

Oh and look, right before Jan 6 party in DC.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

193173  No.12311432

>>12311204

11,780 Q search:

https://share.hsforms.com/11780UBPxQ0GMhNXFrT_J_Q3n0p2

Request AJIC abstract article on "Light-guided nudging and data-driven performance feedback improve hand hygiene compliance among nurses and doctors"

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

b0799f  No.12311433

>>12311420

Oops sorry. Don't know how that happened.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

399f8e  No.12311434

>>12311364

Lizard people

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

75f797  No.12311435

File: 7086f301418ce6f⋯.gif (500.66 KB, 1080x607, 1080:607, 20210104_103504.gif)

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

9cb40c  No.12311436

>>12311405

>was not pardoning this fellow

Like you know better than @POTUS on when/who to pardon?

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

023118  No.12311437

File: 13460407a4aea85⋯.jpg (30.33 KB, 492x544, 123:136, 1567609889963.jpg)

>>12310863

The mayor didn't write that. It was the (((Legal Counsel))) of the Mayor who wrote it.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

193173  No.12311438

>>12311204

11,780 Q search:

VAX - Wikipedia

Search domain en.wikipedia.org/wiki/VAXhttps://en.wikipedia.org/wiki/VAX

VAX is a line of superminicomputers and workstations developed by the Digital Equipment Corporation (DEC) in the mid-1970s. The VAX-11/780, introduced October 25, 1977, was the first of a range of popular and influential computers implementing the VAX instruction set architecture (ISA). Over 100 models were introduced over the lifetime of the design, [citation needed] with the last members …

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

07d1f1  No.12311439

>>12311374

wtf with the last sentence?

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

dcb9e0  No.12311440

File: 542507ff7144cff⋯.mp3 (157.31 KB, 2021_01_04T17_36_08.mp3)

-*-

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

8bd541  No.12311441

YouTube embed. Click thumbnail to play.

Lauren Boebert, New Queen of Congress

‘It is my responsibility to object to electoral vote’

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

193173  No.12311442

>>12311204

11,780Q search:

SANTA CLARITA COMES UP

https://www.santa-clarita.com/home/showdocument?id=11780

Emergency Checklist Flyer 2016 - Santa Clarita, California

Search domain www.santa-clarita.com/home/showdocument?id=11780https://www.santa-clarita.com/home/showdocument?id=11780

q First aid kit, freshly stocked q First aid book q Food q Adjustable wrench for turning o˚ gas q Can opener (non-electric) q Blankets or sleeping bags q Portable radio, flashlight, and spare batteries q Sturdy shoes q Heavy gloves to clear debris q Duct tape, plastic sheeting q Light sticks q Whistle q Essential medications q Extra pair of …

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

0ddfc2  No.12311443

>>12311378

I wonder what police officers are like in the congo? I'll pay for the one way ticket.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

393213  No.12311444

>>12311378

the nigglet is right on this one.

most cops are scum, I know that too.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

99d200  No.12311445

File: 237d492b2107286⋯.jpg (185.52 KB, 1368x771, 456:257, 237d492b21072861516f38b04c….jpg)

File: 17808018126155b⋯.mp4 (751.21 KB, 320x320, 1:1, Fire_Drone.mp4)

File: 2567dce567ab402⋯.mp4 (479.75 KB, 320x710, 32:71, Random_Huge_Fire.mp4)

File: bcc1111190e8e45⋯.mp4 (231.59 KB, 220x400, 11:20, Massive_Fuel_Fire_Kuwait_C….mp4)

File: 180aec3de091e5c⋯.mp4 (2.8 MB, 360x636, 30:53, Random_Massive_Fire.mp4)

>>12310834

This technique was used widely in Iraq and Afghanistan during the Wars. Dates back decades however. Round the same time Sicilians lit cats on fire to burn down forests…

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

b57ae4  No.12311446

Does anyone remember what the date was of that strange announcement at Denver Airport? Anyone have the vid?

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

841da3  No.12311447

>>12311399

My teen said they should rock paper scissors for it

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

dcb9e0  No.12311448

File: 34a4c5bfb8f1721⋯.mp3 (157.31 KB, 2021_01_04T17_36_37.mp3)

***--—-

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

8d25df  No.12311449

Notables Are Not Endorsements

#15715

>>12310914 Bobby Piton insinuating a fake MSM hit piece coming out on him

>>12310905, >>12310924 John Cardillo is unhinged because of Lin Wood

>>12310973 It’s a Planned Panic-demic.`

>>12311007, >>12311010 Shadow strike.

>>12311080 Cheap hair lice drug may cut risk of COVID-19 death by 80 percent: study

>>12311089 How the fake news industry manufactures hoaxes

>>12311096, >>12311139 The 1973 Home Rule Act

>>12311098, >>12311411 Congress Approves Rules Regulating Jan. 6 Electoral Vote Count

>>12311160 Mayor BOWSER has no authority over DC NG. That power belongs to President Trump only due to DC's unique status.

>>12311215 Video Of Dems Objecting to Electoral College Votes

>>12311229, >>12311284 Anon advice DC Travel

>>12311295 Georgia secretary of state's office to hold press conference Monday at 3 P.M.

>>12311378 Project Veritas: Warnock Staff Admits Candidate’s Bias Against Police

>>12311379, >>12311410 Isaac Kappy revisited

>>12311423 Make yourself heard at DOJ.

>>12311425 Netanyahu claims Iran's uranium enrichment to 20 percent is bid to develop nukes

>>12310921, >>12311021 pf

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

a29ff6  No.12311450

>>12311439

*know

got it now?

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

ba7d7e  No.12311451

>>12311350

You're a boom

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

1ed846  No.12311452

File: ecde6904f34ffc7⋯.png (340.81 KB, 535x491, 535:491, Screenshot_2021_01_04_The_….png)

JUST IN: Two House Democrats ask FBI Director to open "immediate criminal investigation" into Trump

https://twitter.com/thehill/status/1346145646760366083

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

c960aa  No.12311453

>>12311435

I hope to see my dear friend again

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

b0799f  No.12311454

Q !!Hs1Jq13jV6 ID: a95dd3 No.11192505 📁

Oct 21 2020 13:41:31 (EST)

The_Great_Awakening_Crowd_Meme_570x350.jpg⬇

Sometimes you can't TELL the public the truth.

YOU MUST SHOW THEM.

ONLY THEN WILL PEOPLE FIND THE WILL TO CHANGE.

Crimes against children unite all humanity [cross party lines]?

Difficult truths.

Q

I believe Chief Justice John Roberts & a multitude of powerful individuals worldwide are being blackmailed in a horrendous scheme involving rape & murder of children captured on videotape.

I have the key to the files containing the videos. I have also shared this information.

https://mobile.twitter.com/LLinWood/status/1345991175690457091

Try again… Kek.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

ecda78  No.12311455

>>12311253

They're the most dangerous because they have absolutely nothing to live for

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

f08cb6  No.12311456

>>12311388

Used to be a bunch of underground nuclear missile silos during Cold War all through the Dakota's.

4 miles NNE of Tyndall, SD is a fuckin cornfeild as far as you can see. Ain't nothing out there above ground. And most of the missile silos were emptied out, imploded or sold to locals for art noveau homes.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

bb57a4  No.12311457

File: eca45130bfe948a⋯.png (140.18 KB, 988x529, 988:529, ClipboardImage.png)

https://factba.se/topic/calendar

POTUS schedule.

President Trump will work from early in the morning until late in the evening. He will make many calls and have many meetings. The President will depart the White House at 6:10PM for a victory rally in Dalton, GA.

The White House

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

fd75bf  No.12311458

>>12311445

slandering Sicily, a multi ethnic nation, on the behavior of a few idiots generations ago . . .

points off.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

088e17  No.12311459

File: 9bc056335c6c045⋯.jpg (189.93 KB, 534x550, 267:275, But_it_do.jpg)

File: 4f6b0a2582a5a83⋯.jpg (33.65 KB, 850x400, 17:8, Gamble_But_it_do.jpg)

File: 55e766bef9fce76⋯.jpeg (37.98 KB, 499x575, 499:575, But_it_Do.jpeg)

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

dcb9e0  No.12311460

File: 461c24bf8144d3b⋯.mp3 (157.31 KB, 2021_01_04T17_37_36.mp3)

-*-

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

e1d914  No.12311461

>>12311403

so he should be freed now.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

8d2e41  No.12311462

>>12311355

117th 80th street

bourne

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

022f3c  No.12311463

>>12311452

Impeachment Part Deux

Enjoy the show.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

2234b7  No.12311464

File: 22b53157b96bab0⋯.jpg (101.31 KB, 900x506, 450:253, rat.jpg)

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

8b0e47  No.12311465

>>12311083

>CSC CORPORATE DOMAINS, INC.

https://www.cscdbs.com

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

ba7d7e  No.12311466

>>12311366

On Trump watch, the FED got eaten by the Treasury.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

393213  No.12311467

>>12311436

I'm not saying Trump's dumb…..

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

11ad7c  No.12311468

>>12311379

it's a just bullshit

The time of wild accusations is over

Proof or it didn't happen

Lin Wood will not be releasing any proof

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

193173  No.12311469

>>12311204

using 11,780 Q as the search:

read this PDF is POTUS showing us something related to the steal of the votes?:

her is just a bit of it:

http://www.vmware.structuredchannel.com/sw/swchannel/CustomerCenter/documents/11780/31589/Horizon_FAQ_-_EN.pdf

Q. What is VMware Horizon?

A. VMware Horizon® is a family of desktop and application

virtualization solutions designed to deliver Windows and

online services from any cloud. With Horizon, VMware

extends the power of virtualization—from data centers to

devices—to deliver desktops and applications with great

user experience, closed-loop manageability, and hybridcloud flexibility.

VMware Horizon 6

Q. What is Horizon 6?

A. Horizon 6 allows IT to deliver virtual or remoted desktops and

applications through a single platform to end users. These

desktop and application services—including RDS hosted apps,

packaged apps with VMware ThinApp®, SaaS apps, and even

virtualized apps from Citrix—can all be accessed from one unified

workspace to provide end users with all of the resources they

want, at the speed they expect, with the efficiency business

demands. Horizon 6 is available in three editions:

Desktops and Applications Delivered Through a

Single Platform

Deliver virtual or remoted desktops and applications through

a single platform to streamline management, easily entitle end

users, and quickly deliver Windows desktops and applications

to end users across devices and locations.

Unified Workspace with Great User Experience

With Horizon 6, IT can deliver desktops and applications to

end users through a unified workspace with Blast Performance

to enable consistently great experiences across devices,

locations, media, and connections.

Applications that can be delivered and accessed through the

unified workspace include:

• XenApp 5.0 and later

• Microsoft RDS-hosted apps and desktops for Windows

Server 2008 and later

• SaaS applications

• ThinApp 5.0 and later

• DaaS desktops and applications

• End users can also use single-sign on (SSO) from their

Unified Workspace Web app portal to sign in to AirWatch

Web Secure Content Locker and to enroll their devices if

Closed-Loop Management and Automation

Horizon 6 ensures that IT can consolidate control, automate

delivery, and protect user compute resources.

Q. What is real-time application delivery?

A. Real-time application delivery allows IT to deliver applications

and data to any number of virtual machines in seconds.

Applications are stored in shared VMDK read-only virtual disks

that instantly attach to VMs by users, groups, or devices. These

applications perform like natively installed applications for end

users providing a seamless desktop experience. App Volumes

is supported in Horizon Enterprise editions

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

193173  No.12311470

>>12311469

>>12311204

VMware, Inc. 3401 Hillview Avenue Palo Alto CA 94304 USA Tel 877-486-9273 Fax 650-427-5001 www.vmware.com

Copyright © 2015 VMware, Inc. All rights reserved. This product is protected by U.S. and international copyright and intellectual property laws. VMware products are covered by one or more patents listed

at http://www.vmware.com/go/patents. VMware is a registered trademark or trademark of VMware, Inc. in the United States and/or other jurisdictions. All other marks and names mentioned herein may be

trademarks of their respective companies. Item No: VMW5708-FAQ-HORZN-USLET-116

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

65da4c  No.12311472

File: 326648101a549b2⋯.jpg (39.59 KB, 611x232, 611:232, 4_1_s.JPG)

>>12311414

And your post # has 4 1's

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

dde3d4  No.12311473

File: 455ebb831fd3e57⋯.jpeg (381.17 KB, 640x973, 640:973, FF2D3A6E_67A3_4F9B_B97E_B….jpeg)

File: d1b0b402d52bf6c⋯.jpeg (272.04 KB, 640x714, 320:357, 997D33BD_F424_4DF5_9679_A….jpeg)

File: 58723420e7d7e31⋯.jpeg (322.47 KB, 640x799, 640:799, 71ED6C7F_56BC_4DA1_9F53_4….jpeg)

File: 16b923c1e0cac41⋯.jpeg (370.54 KB, 640x937, 640:937, 26B866DC_4668_4C55_B559_0….jpeg)

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

c6cd29  No.12311474

File: fb806973bb6ff26⋯.jpg (12.38 KB, 236x176, 59:44, 6ebffd965e7873f80be95e9270….jpg)

>>12311385

a local bulldog I had probs w,

he's a wrench on bikes too,

my wild mind, him as th new boss

at OCC,

th old man ripped w rage,

th guy' tag is big dog,

th old man, I don't see no big dog I see a skinny puppy,

nothing but fights since th new management on OCC,

an adult swim you needa be over 90 years old just cuz th rudest th shit,

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

9eaf72  No.12311475

File: f26d4f357f2064d⋯.gif (2.86 MB, 524x524, 1:1, Elena_Parent_Straight_Jack….gif)

>>12311133

dEbOOnKeD!

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

f56d94  No.12311476

>>12311468

>Proof or it didn't happen

Pretty much.

>Lin Wood will not be releasing any proof

The jury's still out on that one.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

56a3e9  No.12311477

>>12311379

M'ber, the searches were done on yandex.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

fd75bf  No.12311478

>>12311469

provides a definition of 'Real Time' in an odd and new context, dissassciated from it's use traditionally to specify a particular type of control plane for use in . . . specialized applications of critical infrastructure.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

9cb40c  No.12311479

>>12311467

Good. Assange will get his "pardon" when it's his fucking turn.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

b57b27  No.12311480

>>12311452

Little do they yet know that they're the ones actually under investigation.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

9a3f48  No.12311481

>>12310886

Extraordinary My Ass

They are all Deep State civilian pol hacks with the exception of Mattis who I still believe is very much part of the Plan:

Dick Cheney, William Perry, Donald Rumsfeld, William Cohen, Robert Gates, Leon Panetta, Chuck Hagel, Ash Carter, James Mattis and Mark Esper.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

127ae9  No.12311482

>>12311253

I’m not concerned what they look like. I gun them down, search their bodies for things I can use, kick them in the head and move on to the next.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

a29ff6  No.12311483

File: 3eaa4dff7a17a41⋯.png (875.31 KB, 898x1321, 898:1321, ClipboardImage.png)

>>12311403

🎗

Christine Assange #FreeAssangeNOW

@MrsC_Assange

Thank you #TeamAssange…

Its not over till hes safely home & all charges dropped, but today was the best news..

Its been 10 long traumatic years..

I hope I will hold my son again soon..like I did here in 2010

https://twitter.com/MrsC_Assange/status/1346070304464900097

WRWY Julian & Christine

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

19b952  No.12311484

File: 034f151b8e673d0⋯.jpg (119.31 KB, 1280x1290, 128:129, _123.jpg)

>>12311018

Noice Anon

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

393213  No.12311485

>>12311441

One day in, and I'm sure she's already bought and paid for, just like the others.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

56c68e  No.12311486

File: ace948264174b6d⋯.png (212.4 KB, 691x435, 691:435, 84134869113006.png)

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

c67db6  No.12311487

>>12311375

Q actually introduced very little that wasn't already common knowledge among the "conspiracy theorist" types, what this little experiment was successful at the most was getting this knowledge out to a wider audience. Moms on twitter didn't know about Epstein blackmail rings and how to follow the paper trails of corrupt politicians 5 years ago, now it's all they talk about. This has given a lot of people their first taste of just how unwell our world truly is.

However, you are correct in that it isn't enough. People, when faced with a reality-shattering lie, automatically try something just as believable to make their transition out of the lie easier. Usually it's another lie. Many lack discernment still, and take people like Lin Wood at their word because hey, he's telling me what I want to hear so what's the harm?

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

bb57a4  No.12311488

YouTube embed. Click thumbnail to play.

Gotta post this all day long.

https://nationalfile.com/georgia-raffensperger-begged-for-100-chinese-to-vote-for-him-by-mail-in-2015-won-by-159-votes/

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

dcb9e0  No.12311489

File: c6e1cad48d926c9⋯.mp3 (157.31 KB, 2021_01_04T17_39_55.mp3)

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

8d2e41  No.12311490

>>12311452

swallowsccpleiuwell

two triators walking around like thar AMERICAN PATRIOTS

the misgendered leui transitioning to lobotomy

new gender terms: dumas, medulla-less, and dum dum

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

c960aa  No.12311491

Without a constant supply of adrenochrome, the replicas will enter a state of raging madness

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

5a98bb  No.12311492

File: e31bc7949d1c4bf⋯.png (447.13 KB, 989x577, 989:577, anthony_quinn_warner.png)

Anthony Quinn Warner

Death: Suicide

Suicide Squad

Lead: Harley Quinn

Warner Bros film

Producer: Steve Mnuchin

Seems legit.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

ba7d7e  No.12311493

>>12311481

…Eaten whole. Skull, bones, and all.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

95d7d9  No.12311494

>>12311215

The futility of spending sarcasm illustrating the irony of their hypocrisy is exhausting as They are impervious to logic and immune to shame.

Like, from another planet or something. I actually don’t think there has been a fictional monster in all of film nor literature as horrifically terrifying as These so-called “people”.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

dcb9e0  No.12311495

File: 07eee26dafd2061⋯.mp3 (157.31 KB, 2021_01_04T17_40_31.mp3)

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

07d1f1  No.12311496

>>12311395

Feinstein twice

put Justice in front of Beyer

1 L in Lin

which Paul? first name for clarity

Halper is in two columns

keep it up

should be inNotablesso it can grow if you are not around

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

d72ab3  No.12311497

File: 792ebdc5f483e40⋯.png (952.95 KB, 1135x855, 227:171, ClipboardImage.png)

File: fca8494514df36e⋯.png (71.07 KB, 999x620, 999:620, ClipboardImage.png)

File: a3b82ca461c669b⋯.png (199.64 KB, 243x347, 243:347, ClipboardImage.png)

>>12311379

>Forest Scott Proctor

<Thrive

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

98ab4c  No.12311498

File: 53364342ee3f9b5⋯.jpg (221.5 KB, 1200x928, 75:58, Q4881c.jpg)

File: 3607e6860352ad3⋯.png (194.55 KB, 443x450, 443:450, Qanon.png)

File: 274e016fdd63c6a⋯.jpg (630.74 KB, 1980x1020, 33:17, Qanon.jpg)

File: ccea9917ce5add1⋯.jpg (36.31 KB, 474x474, 1:1, Our_guy.jpg)

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

870559  No.12311499

File: 5ec3165a36b000e⋯.jpeg (113.04 KB, 794x500, 397:250, 5DB042BC_51D9_4DB4_AFDF_8….jpeg)

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

3582f6  No.12311500

>>12311350

You're gonna get shit on here by the rest of the anons. But Im right with you. Hang in there. I'm trying to as well!

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

b157a2  No.12311501

File: 3f4f27a2b452aca⋯.jpg (69.96 KB, 680x415, 136:83, watchcaknow.jpg)

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

49fc32  No.12311502

>>12311411

Wonder what ol' Nunes is doing right now? You know he isn't just tucked away somewhere sitting on his hands. But he sure has been quiet through all this - so far

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

8169a2  No.12311503

>>12310953

It would seem to be the edge of complete disaster from which one cannot recover.

Folks won't take anything seriously until their toes are dangling over the edge and the wind starts picking up.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

edaf99  No.12311504

>>12311452

These guys know what 11780 means…PANIC

>>12311469

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

bb57a4  No.12311505

>>12311019

Can't even make it up.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

7e8926  No.12311506

>>12311480

Uh, its the FBI…

The FBI is completely corrupt and cannot be trusted. At this point they are criminals and traitors themselves…

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

dcb9e0  No.12311507

File: 27b1e023d314ea2⋯.mp3 (157.31 KB, 2021_01_04T17_41_25.mp3)

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

399f8e  No.12311508

Hey Q. When will we see JUSTICE?

Asking for anons all over the WORLD.

We need a WIN sir.

o7

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

98ab4c  No.12311509

File: 8ab59ad2ed63963⋯.jpg (224.08 KB, 1200x1187, 1200:1187, Qanon_baker.jpg)

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

a1b27b  No.12311511

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

d5b32d  No.12311512

File: dd687421485d6d3⋯.png (91.2 KB, 270x253, 270:253, Screen_Shot_2021_01_04_at_….png)

File: 6c1fbb3724762e4⋯.png (122.74 KB, 270x300, 9:10, Screen_Shot_2021_01_04_at_….png)

File: 3b6434152b5599e⋯.png (432.6 KB, 373x662, 373:662, Screen_Shot_2021_01_02_at_….png)

>>12311464

RonG! YuDaHo, HornPops, Bombino,LLWoOTan, George, Phil, K9-nights, and the B-Rest of the [F]amm, bon appetito!

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

80e39c  No.12311513

File: a7050ece6a8c708⋯.png (774.91 KB, 647x525, 647:525, ClipboardImage.png)

PRAY FOR EACH OTHER

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

299b63  No.12311514

File: b52640e8c7acec8⋯.jpg (21.11 KB, 179x255, 179:255, 7c82f3f292b9422e006cae6f80….jpg)

File: 2129a5c2c1ce3d5⋯.jpeg (559.53 KB, 1125x2310, 75:154, 7e5c47bb722d1c150b593e5d8….jpeg)

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

4e68dd  No.12311515

File: aec71ac51f4fb70⋯.jpg (316.44 KB, 1191x440, 1191:440, 33_freeman_33_masonic_bott….jpg)

Ruby 'obvious fraud' Freeman: "Special thanks to Stacy Abrams, Keisha Lance Bottoms, and Raphael Warnock."

2020 - year of Zionist-Masonic Psy-ops via Zio-masonic MSM. Luciferian Freemasonry IS Jewish. 'Ordo Ab Chao' via 33

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

167838  No.12311516

File: 331b59686647165⋯.png (90.71 KB, 766x496, 383:248, ClipboardImage.png)

Sauce:

https://amgreatness.com/2021/01/03/defenders-of-civilization/

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

393213  No.12311517

>>12311479

(((they))) should take (((their))) time, it's not like he's dying in solitary or anything.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

c960aa  No.12311518

>>12311508

Have you met yourself yet?

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

a1b27b  No.12311519

File: fa3db68a2b2c166⋯.png (1.36 MB, 1896x1116, 158:93, 4881.png)

>>12311498

Attacks are proof it's over the target.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

257d62  No.12311520

File: 732147a45eab641⋯.jpg (167.72 KB, 1003x831, 1003:831, ZomboMeme_09112020092248.jpg)

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

8169a2  No.12311521

>>12310959

And all urinating on the side of the road.

kek

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

022f3c  No.12311522

>>12311429

This, unless POTUS drops some very large bombs during his rally today. Loeffler and Perdue are on track to lose their bids for the Senate.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

b57b27  No.12311523

>>12311506

Just watch what happens.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

2c08a3  No.12311524

>>12311389

Churchill once said that "…most men, when they stumble over the truth, pick themselves up and hurry off as if nothing happened"! Today, you are that man! You care not for the truth because The Truth threatens your constructed narrative…or, your idol! So be it! Free will!

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

dcb9e0  No.12311525

File: 80dbe46b75ba5e9⋯.mp3 (157.31 KB, 2021_01_04T17_42_43.mp3)

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

193173  No.12311526

>>12311204

all variations of

11,780 Q

'find 11,780 votes'

11780

1 1 7 8 0

11 780 votes

and all other variations should be looked at

could be a lead from POTUS?

Such a specific number and so much on the internet that is fishy in relation

11,780 Q

is where i began

the tecnical and computer stuff may be the purpose ?????

sure is weird all the things with bits and pieces of what we all have been digging on over the years

is 11,780 some thing the cabal/DS use to communicate COMMS?

>>12311211

>>12311221

>>12311233

>>12311236

>>12311247

>>12311249

>>12311254

>>12311261

>>12311268

>>12311277

>>12311283

>>12311293

>>12311313

>>12311355

>>12311368

>>12311376

>>12311390

>>12311406

>>12311422

>>12311432

>>12311438

>>12311442

>>12311469

>>12311470

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

99d200  No.12311527

File: 560cf59d65abaa0⋯.mp4 (525.35 KB, 480x480, 1:1, Black_Lives_Matter_Burning….mp4)

File: b4df53713f0eecd⋯.jpg (180.83 KB, 814x814, 1:1, Cadillac_McNigger.jpg)

File: dba3b309c57a869⋯.jpg (53.45 KB, 547x302, 547:302, McNigg_is_Back.jpg)

File: 61974517646d748⋯.jpg (60.31 KB, 547x302, 547:302, Foxy_Ribbed.jpg)

File: 63f582bb05c1910⋯.png (2.27 MB, 1349x1966, 1349:1966, 1597406246856.png)

>>12311349

Pssssst….

The McNigg is Back!!!

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

870559  No.12311528

File: 5eacdfc05147bf4⋯.jpeg (118.21 KB, 1200x744, 50:31, 61A784FF_DACE_40E6_9393_6….jpeg)

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

1e91c9  No.12311529

File: 3a901edcf034cf1⋯.jpg (129.5 KB, 675x766, 675:766, binoc_kek_.jpg)

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

393213  No.12311530

>>12311483

this is fucking sad.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

c78e02  No.12311531

>>12311242

Still sad Henry Cavill doesn't want to fuck you, hunh?

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

4c76f7  No.12311532

File: 298ad1bc6d11d01⋯.jpg (39.67 KB, 932x663, 932:663, laffguypopcorn.jpg)

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

a29ff6  No.12311533

File: 73f19def6573719⋯.jpg (255.85 KB, 1050x759, 350:253, Screenshot_2020_12_18_bide….jpg)

File: fee393e01957d19⋯.png (734.26 KB, 450x600, 3:4, Screenshot_2020_12_18_JRB_….png)

File: a38a7697c09bc40⋯.png (1.7 MB, 1067x711, 1067:711, Screenshot_2020_12_18_bide….png)

File: e57b39fdd63d6cf⋯.png (1.59 MB, 1067x600, 1067:600, Screenshot_2020_12_18_bide….png)

File: 1a7d00a7f89a8da⋯.png (197.42 KB, 481x270, 481:270, Screenshot_2020_12_18_bide….png)

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

d7aecf  No.12311534

>>12311522

Thanks to that fucking cunt Mitch.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

ba7d7e  No.12311536

>>12311469

so the voting stuff isn't even hosted on the local machines?

and xenapp sux.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

631631  No.12311537

>>12311508

Since the MSM is untrustworthy and the politicians are corrupt how will you know when 'we' get a win?

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

6e196c  No.12311538

>>12311081

4 dead in Ohio. (Kent St)

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

b157a2  No.12311539

File: 514a11e33119ff8⋯.jpg (59.86 KB, 308x231, 4:3, tomhankstype.jpg)

File: 17b8a086ed9352e⋯.jpg (64.39 KB, 680x503, 680:503, hanks.jpg)

Hanks records the evidence of his kills.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

8d25df  No.12311540

Notables Are Not Endorsements

FINAL

#15715

>>12310914 Bobby Piton insinuating a fake MSM hit piece coming out on him

>>12310905, >>12310924 John Cardillo is unhinged because of Lin Wood

>>12310973 It’s a Planned Panic-demic.`

>>12311007, >>12311010 Shadow strike.

>>12311080 Cheap hair lice drug may cut risk of COVID-19 death by 80 percent: study

>>12311089 How the fake news industry manufactures hoaxes

>>12311096, >>12311139 The 1973 Home Rule Act

>>12311098, >>12311411 Congress Approves Rules Regulating Jan. 6 Electoral Vote Count

>>12311160 Mayor BOWSER has no authority over DC NG. That power belongs to President Trump only due to DC's unique status.

>>12311215 Video Of Dems Objecting to Electoral College Votes

>>12311229, >>12311284 Anon advice DC Travel

>>12311295 Georgia secretary of state's office to hold press conference Monday at 3 P.M.

>>12311378 Project Veritas: Warnock Staff Admits Candidate’s Bias Against Police

>>12311379, >>12311410 Isaac Kappy revisited

>>12311423 Make yourself heard at DOJ.

>>12311425 Netanyahu claims Iran's uranium enrichment to 20 percent is bid to develop nukes

>>12311452 Two House Democrats ask FBI Director to open "immediate criminal investigation" into Trump

>>12311457 POTUS schedule

>>12311483 Christine Assange #FreeAssangeNOW

>>12311395 Anon list: good guys, bad guys

>>12310921, >>12311021 pf

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

2234b7  No.12311541

File: b4b88f0fcd2237b⋯.png (597.49 KB, 926x582, 463:291, chooseme.png)

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

01634b  No.12311542

File: 4b6c0bbbe954c21⋯.png (1.08 MB, 822x870, 137:145, 1605033405.png)

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

167838  No.12311543

If these assholes don't think we are going to liberate our children from the rule of these sociopaths, boy oh boy are they in for a surprise.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

7f1802  No.12311544

FUCK!

DOW IS DOWN 700 POINTS!

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

4dce7a  No.12311545

>>12311349

Epaulettes to make her feel empowered or something?

She looks like she will be one of 'Nancy's Noisy Ones' in the house.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

022f3c  No.12311546

File: 04a381264872b5c⋯.jpg (470.34 KB, 1126x512, 563:256, Epstein_temple_and_gold_ph….jpg)

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

8169a2  No.12311547

>>12310966

Sounds about right….

winds of doctrines and all.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

b157a2  No.12311548

>>12311533

the girl has a little red bracelet

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

f08cb6  No.12311550

>>12311404

Lin wrote about that last week.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

beff4d  No.12311551

>>12311397

look at that title: ON MOTION TO TABLE THE MOTION TO POSTPONE TO A CERTAIN DAY

Fucking Orwellian doublespeak bullshit. Modern law is itself a crime and anyone who manipulates it like this is a fucking crook.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

07d1f1  No.12311553

>>12311411

>The certificates and papers will be opened, presented, and acted upon in alphabetical order, starting with Alabama.

>

>This is when dozens of Republicans—50 representatives and 12 senators, according to an Epoch Times tally—are planning to object to some certificates, alleging election irregularities including voter fraud and failure to follow state election laws.

so objections after all states have been tallied?

one 2 hour session, or 50 2 hour sessions?

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

50fd09  No.12311554

File: 3cb1c10bfe46429⋯.jpg (18.44 KB, 188x251, 188:251, Screenshot_2021_01_04_imag….jpg)

>>12311385

muh costume is gay

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

70af41  No.12311555

File: 1d8eee131b83ef2⋯.jpg (8.73 KB, 240x300, 4:5, quinn.jpg)

>>12311492

There's a video about how Steve Mnuchin ties in (produced many movies).

DOn't forget anthony quinn

amazing polly did a vid showing his various roles and unique life and connections. He seems to be a CIA operative and roles played are like color revolutionists. Also did a movie called the Christmas eve bombing with a similar plot (but robbing a bank)…or bank of servers?

the title was changed though when released.

Then there's Time Warner

not the first time we've seen these sort of names.

Remember Adam Ward from WDBJ fake shooting and all the batman symbolism surrounnding it?

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

022f3c  No.12311556

>>12311544

That is how to tell we are winning.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

a1b27b  No.12311558

>>12311544

Likely pharma companies now that price transparency has decreased their market value.

just a guess

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

dcb9e0  No.12311559

File: 493df204b982bd8⋯.mp3 (157.31 KB, 2021_01_04T17_45_46.mp3)

-*---

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

9cb40c  No.12311561

>>12311487

Yep. Q has been great, and shown this anon just how bad it really is, out there. The absolutely insane amount of shit really is mind blowing, but none of it surprised me in the least. Shocking? Sure. Surprising, though? Maybe all that "soft disclosure" I've been exposed to in music/movies/tv just makes it all so much more believable.

>>12311517

He's not dying. He's in the safest place he could possibly be in. Anons should know this already.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

4dce7a  No.12311562

>>12311544

You're still short SWI, right?

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

b157a2  No.12311563

File: 0d6e50f68c3f4a3⋯.jpg (287.06 KB, 959x1440, 959:1440, aqislam.jpg)

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

9c9792  No.12311567

>>12311430

shit jewish meme

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

a867eb  No.12311568

>>12311350

yea we all go back and forth with panic and then hope, we have 2 days to see what Trump has up his sleeve. I think we can wait at least until then kek

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

5a98bb  No.12311570

>>12311452

>ask FBI Director to open "immediate criminal investigation" into Trump

Finally something the FBI is competent at!

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

f08cb6  No.12311571

>>12311349

Good lord! These demon people are horrifying!

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

6870c8  No.12311573

>>12311081

Not Kent state

The veterans DC March

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

000000  No.12311574

>>12310994

How about release one convincing sample as proof - that would wake up the world overnight.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

99d200  No.12311575

File: 09c87548af612d5⋯.mp4 (969.25 KB, 640x360, 16:9, WAR.mp4)

File: 50000f765d2ec81⋯.gif (4.57 MB, 640x480, 4:3, Mexi_CAN.gif)

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

c67db6  No.12311576

File: 27224600f5721b6⋯.jpg (25.63 KB, 681x422, 681:422, 1572235411544.jpg)

>>12311544

Maybe we'll have a flash crash, that would be pretty entertaining.

Or better yet BTC has a massive dump and all the cryptofags lose their asses.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

6666a1  No.12311577

Q drop 4685

09/12/2020

"Only at the precipice will people find the will [strength] to change and break the system of control [be free]."

Q Team told us that POTUS will bring this Republic to the precipice of destruction before it can be saved… don't expect anything to happen on January 6th.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

ea3c45  No.12311578

I know, I know…trust the plan… but have to admit I'm sick to my stomach thinking Biden will be sworn in.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

4a8786  No.12311579

File: 09eaf637b3c4152⋯.png (3 MB, 1903x930, 1903:930, ClipboardImage.png)

>>12311499

i recently spotted a new sacrifice temple at the kremlin in the movie sum of all fears. its at 26:00 on netflix.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

80e39c  No.12311580

>>12311395

Adm Rogers works with Unit 8200

Ex-NSA employees criticize Mike Rogers' role with Israeli venture firm

https://www.cyberscoop.com/mike-rogers-team8-nsa-board-criticism-unit-8200/

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

4470a2  No.12311581

>>12311452

Kekekeke

Trying to Impeach a sitting President that is, according to them, going to be out of office in 16 days.

That doesn't smell like them winning, it smells of them being sore losers.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

a29ff6  No.12311584

>>12311574

nope. brings everyone down. you SAVE these children, you do not exploit them. fucking SHITFORBRAINS.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

ba7d7e  No.12311585

YouTube embed. Click thumbnail to play.

>>12311544

a FRN inferno!!!

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

a867eb  No.12311587

>>12311568

If Trump does not have something massive to reveal on Wednesday then we can start to panic I think.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

ef5c37  No.12311589

'Disgusting': Perdue hammers Georgia secretary of state for recording Trump call

https://www.politico.com/news/2021/01/04/perdue-hammers-ga-sec-state-recording-trump-call-454496

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

aaa771  No.12311590

>>12310921

Oak Ridge National Labs

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

748849  No.12311591

File: 464df6f9a4d9178⋯.jpg (74.29 KB, 1280x720, 16:9, jfk_film_kevin_costner_128….jpg)

>>12311544

Gentlemen, this will be a week to remember.

Buckle up, it's only going to get worse.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

4dce7a  No.12311592

>>12311558

>Likely pharma companies now that price transparency has decreased their market value.

>>just a guess

Bad guess, tech is experiencing the biggest percentages in losses

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

332f1b  No.12311593

>>12311576

>Or better yet BTC has a massive dump and all the cryptofags lose their asses.

A quantum computer would break blockchain easily that’s why I don’t mess with crypto. Too much of a short shelf life.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

07d1f1  No.12311594

>>12311450

ty dear

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

167838  No.12311595

>>12311374

https://en.wikipedia.org/wiki/Lizard_Squad

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

a1b27b  No.12311596

>>12311567

Shit muhjoo reply/deflection.

Would you prefer another dictator defunding police so as to make room for federal terror police forces? Stalin, Mao, Mussolini?

Take your pick division faggot, it's all the same to normal healthy freedom loving people.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

023118  No.12311597

>>12311580

Gargantuan if verified.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

b157a2  No.12311598

File: 12a14c1b37a992d⋯.jpg (28.1 KB, 271x271, 1:1, 27b05b4dbed3d5894a541a4608….jpg)

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

085701  No.12311599

>>12309477

>>12310896

Also [E] is incorrect. To think Roberts will sacrifice his 2 adopted children is ludicrous. If one of them were to die, it would be too obvious. The question is what did Robert's do to buy children through Epstien. Also, still no in stone sauce Epstien is still alive.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

a29ff6  No.12311600

>>12311594

welcome.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

8bd541  No.12311601

File: 709dfd44208e7fd⋯.png (489.38 KB, 600x500, 6:5, Screenshot_2021_01_04_Trum….png)

File: 9e790adf087fc7a⋯.png (225.48 KB, 697x2310, 697:2310, Screenshot_2021_01_04_Trum….png)

File: b00f651f27c9c28⋯.png (175.63 KB, 658x1848, 47:132, Screenshot_2021_01_04_Trum….png)

File: 8a23916402150d6⋯.png (203.52 KB, 668x2218, 334:1109, Screenshot_2021_01_04_Trum….png)

File: e6f7adaf51a7279⋯.png (297.89 KB, 728x3091, 728:3091, Screenshot_2021_01_04_Trum….png)

Trump Ga. Transcript Shows Case for Vote Fraud, President Acted Properly (Call Transcript)

The Washington Post on Sunday released audio of a Saturday phone call between President Donald Trump and Georgia Secretary of State Brad Raffensperger in which the two can be heard discussing election results. The Post initially released snippets of the hour-long call in which Trump can be heard discussing election results with Raffensperger and his lawyer Ryan Germany. Also joining the call was White House chief of staff Mark Meadows and Trump campaign lawyer Cleta Mitchell. Trump lays out numerous examples of double voting, dead people voting, and other ballot irregularities and anomalies. Raffensperger and Germany counter Trump's assertions largely with simple claims that the matters Trump raised have been investigated. Trump insists he won Georgia's presidential election on Nov. 3 and claims widespread fraud deprived him of that victory. The Washington Post claimed that in his talk with Raffensperger, Trump "repeatedly urged him to alter the outcome of the presidential vote in the state." This claim is false. The transcript of the call shows Trump demanding an honest accounting of the ballots, which he says would give him more than 11,000 votes. Several key excerpts of the conversation follow.

https://www.newsmax.com/politics/trump-georgia-raffensperger/2021/01/03/id/1004057/

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

65da4c  No.12311602

>>12311555

>Steve Mnuchin

Interesting list of credits

https://m.imdb.com/name/nm6518391/filmotype/producer?ref_=m_nmfm_1

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

4a7074  No.12311603

>>12311452

>JUST IN: Two House Democrats ask FBI Director to open "immediate criminal investigation" into Trump

Didn't we already go thru this like 4 years ago?

Can someone teach these fuckers how to have an original thought?

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

4c76f7  No.12311604

>>12311575

"These people are stupid" aged well.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

022f3c  No.12311605

>>12311491

After three years, we have exactly zero evidence that adrenochrome has anything to do with all of this.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

ba7d7e  No.12311606

>>12311593

sif the ccp hasn't been manipulating crypto…

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

4dce7a  No.12311607

File: 9a5ea613db2f755⋯.jpg (33.36 KB, 384x377, 384:377, Nailed_It.JPG)

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

70af41  No.12311608

File: b17dcf0eba7487f⋯.jpg (44.99 KB, 640x480, 4:3, alison.jpg)

File: fa8555870925f90⋯.jpg (19.44 KB, 308x400, 77:100, alison_batman.jpg)

>>12311555

pic related…there was a photo of her dressed in batman attire on her old FB. Can't find it….same for the other guy Ward and the fake wound makeup on both. So obvious an op

>>nice find

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

6381ea  No.12311609

LPence sounds like a democrat! Wtf?

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

d7aecf  No.12311611

File: f406e8f89ca9f9e⋯.png (171.03 KB, 585x304, 585:304, robert_lee_little_bobby.png)

File: 9e05904d767dca6⋯.png (73.87 KB, 600x564, 50:47, robert_lee_race.png)

File: 7ea5a249d4b5f40⋯.png (43.33 KB, 598x330, 299:165, robert_lee_blm.png)

File: a86d1c384909106⋯.png (38.46 KB, 588x325, 588:325, robert_lee_kneel.png)

>>12311580

>Robert Lee

This is the guy from the article who was mad at Rogers. Look at the filth that this sick fucker puts out. Leads me to believe that Mike Rogers's work was for a good cause.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

477ea4  No.12311612

>>12311562

I don’t short

Betting to lose seems like bad karma

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

a1b27b  No.12311613

>>12311592

If true I think that's notable.

Post sauce, anon, and ping baker.

Tech companies getting hammered is relevant….insiders drive market prices so maybe something big is happening…

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

b157a2  No.12311614

File: 92dce19d83d4220⋯.jpg (87.71 KB, 680x383, 680:383, boompepe.jpg)

>>12311587

Let's do it today- 2 days ahead of schedule

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

80e39c  No.12311615

File: dc8ea6da965bfcb⋯.png (92.69 KB, 649x726, 59:66, ClipboardImage.png)

>>12311597

>>12311597

It is verified

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

022f3c  No.12311617

>>12311601

He acted properly on the Ukraine call too. They still impeached him. They will do it again.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

327bc8  No.12311618

File: ed82fd688070482⋯.png (44.67 KB, 602x478, 301:239, ClipboardImage.png)

https://twitter.com/LLinWood/status/1346151157878697984

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

6381ea  No.12311619

https://www.facebook.com/ABCNews/videos/831815804050197/

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

b0799f  No.12311620

>>12311454

These videos are the ones that the left and media have been yelling about being "deep fakes". These are what they were scared of being released. They were warned if they didn't give in these would be released. Tit for tat game of chicken continues.

>Sometimes you can't TELL the public the truth.

>YOU MUST SHOW THEM.

>ONLY THEN WILL PEOPLE FIND THE WILL >TO CHANGE.

>Crimes against children unite all humanity [cross party lines]?

>Difficult truths.

Stage set.

Release before the 5th? That would be interesting affect on Georgia election.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

1ed846  No.12311621

File: 3d78fa2cf309cd9⋯.png (159.09 KB, 500x573, 500:573, 3d78fa2cf309cd969866a06523….png)

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

56c68e  No.12311622

File: df913f22193be17⋯.png (208.06 KB, 691x435, 691:435, 0547896001276453.png)

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

4e68dd  No.12311623

We know as much. It's time for the sheeple to know as well.

https://laitonlehti.net/2019/09/10/did-epstein-and-maxwells-bug-the-internet/

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

870559  No.12311624

File: 3ee775f2b47f352⋯.jpeg (39.19 KB, 215x255, 43:51, EDB400A8_25F6_4BC6_81F0_C….jpeg)

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

d7aecf  No.12311625

>>12311601

Like I expected, another perfect phone call.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

3bb08e  No.12311627

File: 8a0e2024a57be70⋯.png (310.63 KB, 606x485, 606:485, muhjoos.png)

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

a867eb  No.12311628

>>12311618

Lin Wood covering his ass for defamation

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

022f3c  No.12311629

>>12311618

His credibility is going up in smoke today.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

399f8e  No.12311630

>>12311618

well he hit the brakes pretty fast now didn't he?

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

a3f4a4  No.12311631

>>12311415

>>12311415

Dag nab it, I bin Posting dat

fer de last week now, and

Yoor de furs wun nize enuf

to poyn dat out twoo me !

Tenk Yoo ! !    

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

6381ea  No.12311632

>>12311603

Probably trying to find out who Q is. Pray Anons.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

a29ff6  No.12311633

File: a96eeb913717ea8⋯.png (448.73 KB, 888x488, 111:61, wearethenewsnow.png)

>>12311614

everyone should gather in DC TOMORROW instead.

the element of surprise

\plus it would be funny

and costumes!

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

b02bb8  No.12311634

File: f060e353ebd0c7b⋯.png (458.23 KB, 612x347, 612:347, oss_panel_5_2_bobs.PNG)

>>12311519

>Attacks are proof it's over the target.

your interpretation is not a fact.

nice try

faggot

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

47cf17  No.12311636

File: fa6752b14a4b210⋯.jpg (290.3 KB, 1200x1200, 1:1, fa6752b14a4b210fd635569f74….jpg)

>>12311622

The 'only' nazi's. FTFY

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

95e38e  No.12311638

File: 5b4c57954bbd361⋯.jpeg (258.98 KB, 640x639, 640:639, 13853426_CE39_4F20_A51A_B….jpeg)

>>12311618

More of this …

Of course…

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

b157a2  No.12311640

>>12311633

Fantastic idea

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

f7df61  No.12311642

>>12311108

Didn't POTUS tweet the word Guardians today, the 4th? Big panic on the 5th? FISA bringing down the house on the 6th?

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

a29ff6  No.12311643

>>12311631

it's like when your zipper is open and no one says anything to you

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

9eaf72  No.12311644

>>12311587

>then we can start to panic

I'll reevaluate my position relative to Q beginning the day after DJT leaves office. No sooner.

Precipice.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

ba7d7e  No.12311645

>>12311628, >>12311629, >>12311630

Bets are on that lin got the attention of shills with experience, kek.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

70af41  No.12311646

YouTube embed. Click thumbnail to play.

>>12311602

Oh wow. Inherent vice is one of my favorite movies. Def Q related topics…drug/human trafficking, MKUltra, Cults, Hollywood, BLM(black panthers),psyops, FBI, etc.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

f56d94  No.12311647

>>12311618

That name has been on QR since forever.

https://qresear.ch/?q=holmseth

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

f08cb6  No.12311648

>>12311452

We could pay the national debt just with Pay per View on Ted Lieu's Treason Tribunal and execution!

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

a97eec  No.12311649

TYB

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

3bb08e  No.12311651

>>12311628

Lin Wood is not the "cover your ass" type.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

ff2432  No.12311652

>>12311544

Gold and Silver are predictably up

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

4dce7a  No.12311654

File: 68c4bf25b00da1f⋯.jpg (97.33 KB, 688x1024, 43:64, horsemen.jpg)

The End is Near.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

b57b27  No.12311656

>>12311618

I've been saying for a couple years now that some of these high profile people need advisors like us - people who scour the internet and research night and day. A lot of these "traps" they fall into could be easily avoided with the right person on their team.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

56c68e  No.12311657

File: af42a1bc49f9193⋯.png (199.51 KB, 691x435, 691:435, 546089712096843.png)

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

e1d914  No.12311658

>>12311580

good guy or bad guy?

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

8d25df  No.12311660

File: 59c828f8c28d731⋯.png (1.51 MB, 978x1148, 489:574, 59c828f8c28d731b20b2769816….png)

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

b0799f  No.12311661

>>12311454

Interesting I don't even get a comment from the shill teams… don't want to touch it?

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

841da3  No.12311662

>>12311620

Air the blackmail video on the jumbotron at the rally

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.



[Return][Go to top][Catalog][Nerve Center][Random][Post a Reply]
[]
[ / / / / / / / / / / / / / ] [ dir / random / animus / ausneets / cyber / feet / htg / lit / mental / sapphic ]