8d25df No.12310764[Last 50 Posts]
Welcome To Q Research General
We are researchers who deal in open-source information, reasoned argument, and dank memes. We do battle in the sphere of ideas and ideas only. We neither need nor condone the use of force in our work here.
"We hold these truths to be self-evident: that all men are created equal; that they are endowed by their Creator with certain unalienable rights; that among these are life, liberty, and the pursuit of happiness."
VINCIT OMNIA VERITAS
SEMPER FIDELIS
WWG1WGA
Q's Private Board
>>>/projectdcomms/ & Q's Trip-code: Q !!Hs1Jq13jV6
Q's Latest Posts
Tuesday 12.08.2020
>>11953143 ————————————–——– We're Not Gonna Take It (CAP: >>11953295)
Onion Link
Access through Tor http://jthnx5wyvjvzsxtu.onion/qresearch/catalog.html
New here? Q Proofs & Welcome
Welcome to Q Research (README FIRST, THEN PROCEED TO LURK) https://8kun.top/qresearch/welcome.html
100+ Q Proof Graphics qproofs.com
8kun FAQs https://8kun.top/faq.html
Find Q drops here
Main QAnon.pub - qresear.ch/q-posts - QAlerts.pub - operationQ.pub - QPosts.online - qanon.news/Q - 8kun.top/qresearch/qposts.html
Backups qntmpkts.keybase.pub - QAlerts.app - QAlerts.net - douknowq.com/134295/Q-Anon-Pub.htm - we-go-all.net/q.html -
Dealing with Clowns & Shills
New? Use logic and reason when evaluating posts, look beyond the content of the post(s) and evaluate intent.
>>2322789 How To Quickly Spot A Clown
____________________________
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
8d25df No.12310769
Global Announcements
>>12263192 Anon uploaded the Video about Election Fraud that Youtube deleted from POTUS Youtube account - SHARE SHARE SHARE
>>11509939 AN OFF BREAD RESOURCE FOR DOMINION/SMARTMATIC
>>12236190 Know the gun laws of Washington DC if you go there on the 6th
Report Election/Voter Fraud Directly to Sidney Powell https://defendingtherepublic.org
Support Lin Wood https://fightback.law/
Support Sidney Powell https://defendingtherepublic.org/
CM Research "Executive Directive 51" https://mobile.twitter.com/CodeMonkeyZ/status/1337927415465533440
CM YOUTUBE ARCHIVE https://rumble.com/vbij1v-dominion-voter-fraud-drama-bombshell-video-by-ron-codemonkey.html
Notables Are Not Endorsements
#15714
>>12310096, >>12310239 Patrick Byrne tweets
>>12310138 Over 432,000 Votes Removed From Trump in Pennsylvania
>>12310163, >>12310332 DJT tweet
>>12310175 Mexico offers political asylum to Julian Assange
>>12310227 Here's how Merkel and von der Leyen urged the health minister to cede the vaccine mandate to the EU
>>12310295, >>12310390 "intel LIN gence" Q #4
>>12310320 Lin Wood fire side chat
>>12310277, >>12310286, >>12310293, >>12310340, >>12310436 Anon theory: All [3] movies playing simultaneously?
>>12310401 Lin Wood tweets
>>12310411 Ted Cruz Discusses January 6th Electoral Certification
>>12310484 Nicola Sturgeon announces lockdown in Scotland from midnight
>>12310523 The dictatorship of the Chinese Communist Party is allied to the global deep state
>>12310575, >>12310639, >>12310712 Raffensperger BEGGED For 100 Chinese To Vote For Him By Mail in 2015, Won By 159 Votes
>>12310584 United Kingdom is raising the nationwide #COVID19 alert level to 5
>>12310636 Queen's cousin Lady Mary Colman dies aged 88
>>12310646 President Donald Trump Rally LIVE in Dalton, GA 1/4/21 (3h)
>>12310693 Anti Lockdown protesters flooded Nuremberg last night
>>12310704 Washington DC @MayorBowser is requesting support by the National Guard for January 6th
>>12310715 New Year, New Sailors!
>>12310475, >>12310709 pf
>>12310756 #15714
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
8d25df No.12310772
#15713
>>12309283 James O'Keefe says he had UNDERCOVER people in GA. for months
>>12309321 C Herridge - British judge rejects US request to extradite WikiLeaks founder Julian Assange to face espionage charges, saying it would be "oppressive" because of his mental state.
>>12309327 KANSAS IS SAVAGE (video)
>>12309328 , >>12309959 Twitter Account for https://twitter.com/MikayesFiona is now suspended, She was pushing for everyone to call and email Congress re: election fraud
>>12309342 Grenell, after going off DNI, was main person involved into making peace between Serbia and Kosovo.
>>12309351 The prayer to open the 117th Congress ended with "amen and a-women." (video)
>>12309409 FF in Queens? - Reports of 'vehicle with explosives'
>>12309461 Lin Wood - The number of missing children worldwide & in the USA is staggering (Seems consistent with what Q has been dropping.)
>>12309477 Anon opines that with Lin Wood disclosures patriots are in control and about to cross the Rubicon
>>12309564 Ron supports Lin Wood. Trump retweets Rons posts lately. If Lin is crazy then Ron is also? Then Trump is also? Then aprox 75mil voters are also?
>>12309594 @JamesOKeefeIII 11h Veritas has had an team of undercover agents in Georgia for months.
>>12309653 Spanish King Juan Carlos, 82, looking very frail
>>12309668 Boris Johnson to address UK on new China Virus lockdowns
>>12309712 Bannon War Room Live (video link)
>>12309718 Americans Own 40 Percent of World's Guns
>>12309737 DJT - How can you certify an election when the numbers being certified are verifiably WRONG
>>12309777 Patriot Jovan Pulitzer’s Team Is Being Shot At! – After They Were Given Directive to Identify Fraudulent Ballots in Fulton County
>>12309807 O'Keefe - Dem GA Sen Candidate Warnock's staff admit candidate's bias against police.
>>12309813 DJT - You will see the real numbers tonight during my speech, but especially on JANUARY 6th
>>12309825 President / Vice President 'contingent election' explained
>>12309841 Michelle Malkin - Dems are mentally and womentally deranged (Prayer for Congress ends with 'amen' and 'awomen'
>>12309863 Israel completes Iron Dome delivery to US Army
>>12309881 , >>12309889 Detention Camps for people exposed to China Virus?
>>12309885 Jovian Pulitzer - My team has been provided with evidence of mail in ballots with the votes already filled in BY MACHINE
>>12309886 NEW DJT “We’ve seen in the last few months, unprecedented amounts of Voter Fraud.” @SenTedCruz True!
>>12309896 Look at this Q drop. Child sacrifice (Q Post 703)
>>12309926 DJT - We are not acting to thwart the Democratic process. We are acting to protect it - Sen Ron Johnson
>>12309937 Kevin McCarthy Announces Support for Challenge to Electoral College
>>12309972 Patrick Byrne thread - starts with - ' Read and retweet as though your life depends on it, which it does.'
>>12309977 Rep. Liz Cheney (R-WY) and former House Speaker Paul Ryan (R-WI) are attacking Republican lawmakers who plan to challenge the electoral college
>>12310005 #15713
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
8d25df No.12310774
#15712
>>12308469 “ President Donald Trump is in a “really good position” for Wednesday’s challenge in Congress, according to former Director of National Intelligence Ric Grenell.
>>12308482 If you're going to the @MilionMagaMarch BRING WALKIE TALKIES! Your phone WILL NOT WORK!
>>12308488 Lin Wood's Jan 4th Tweet Storm consolidated into a video
>>12308576 Trump 'just plain wrong' on fraud claims: Georgia Secretary of State Raffensberger defends his corruption
>>12308590 Bail Decision on Wednesday! Julian Assange Hearing - Outside the Old Bailey Live
>>12308592 Chinese billionaire Jack Ma is missing after criticizing the Chinese government. Wow. This would be like the U.S. government kidnapping Jeff Bezos or Mark Zuckerberg to teach them a lesson.
>>12308601 Precipice comms in the Mark Levin video POTUS tweeted last night. "We're standing at the precipice and we're looking into the abyss."
>>12308605 Julian Assange: British judge rejects US's request to extradite WikiLeaks founder
>>12308608 5 Florida Judges Reprimanded in $500 Million Child Welfare Agency Conflict
>>12308609 Reducing our Food Supply – Is it Intentional?
>>12308612 Kamala Harris sworn in as US Senator on Sunday
>>12308617 Anon dig on Pompeo's use of " China's Pangolin's Nose"
>>12308626 Johnson & Johnson's single-dose vaccine next to seek emergency use authorization
>>12308691 Joseph J Flynn - retweet of Jovan Pulitzer - one of his team members took 5 shots through the windows on a drive by
>>12308693 Disabling the camera and microphone in smart tvs?
>>12308721 BBC News pushing this 'find me more votes' story to discredit POTUS
>>12308722 400,000 kids missing in US every year. 350,000 US people reported dead from coronavirus this year. Yet MSN never seems to say a word about the children.
>>12308734 Judge blocks Assange extradition, saying US Prison System can't protect him
>>12308740 Jon Voight: America (video)
>>12308749 Seven days in January? Former Def Secretaries warn Trump over Election Fight
>>12308797 PANIC DC says no guns allowed during MAGA election protest
>>12308813 Iran 'resumes enriching uranium to 20% purity at Fordo facility'
>>12308815 Assange case adjourned until Wednesday the 6th of January. Assange remains behind bars
>>12308834 Tom Fitton - URGENT! Call state legislators in PA, GA, MI, WI, NV, and AZ to share what you think about appointing clean slate of electors for @realDonaldTrump
>>12308839 CM - Pray for the families of the missing children. Pray for Lin Wood for standing as a beacon of light
>>12308847 Additional COVID-19 restrictions imposed last month in Pennsylvania have expired
>>12308856 Mexican Coyotes Abandon 48 Migrants in Winter Storm near Border, 2 Dead
>>12308890 , >>12308944 Leon Panetta’s Communist Friend, and the Chinese Spy - Obama’s CIA Director Linked to Spies Through Communist Party Figure
>>12308894 Chicago holiday weekend gun violence leaves 30 shot, 5 killed across city
>>12308898 White House Planning to Refer Brad Raffensperger to Secret Service for Investigation Under the Espionage Act
>>12308911 CM tweet referring to the danger of data miners challenging the Election Fraud
>>12308982 Tom Cotton Statement on Joint Session of Congress (Cotton ok with massive election fraud)
>>12309042 Moderna/Pfizer vaccines are not a vaccine, they are mRNA gene therapies - Genetic Scientist Alexandra Caude (Video)
>>12309052 Masks conceal the identity of children making it easier to transport them in human trafficking/smuggling
>>12309050 OAN report - Space Aliens have visited Earth (Video)
>>12309054 2nd Marine Division - Learn to fight in the cold
>>12309078 CIA assets killed in China soon after Leon Panetta took office
>>12309121 TRUMP DROPS A BOMB DURING PHONE CALL! Tells Raffensperger “Vote Scammer and Hustler” Ruby Freeman Was Behind 18,000 FRAUDULENT VOTES
>>12309134 OAN Report from 9am EST - Trump Rally / VP Pence Rally both in GA 12pmEST POTUS files suit against GA SOS More evidence of vote/election fraud (Video)
>>12309146 O'Keefe - Warnock (GA Sen Dem Candidate) staff admit Warnock's bias against Police
>>12309191 Rep. Elise Stefanik will object to certifying Electoral College results
>>12309211 #15712
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
8d25df No.12310777
Previously Collected Notables
>>12308368 #15711
>>12306038 #15708, >>12306817 #15709, >>12307603 #15710
>>12303525 #15705, >>12304263 #15706, >>12305316 #15707
>>12301149 #15702, >>12301952 #15703, >>12302750 #15704
>>12298260 #15699, >>12299427 #15700, >>12300364 #15701
>>12295924 #15696, >>12296674 #15697, >>12297537 #15698
>>12293350 #15693, >>12294316 #15694, >>12303022 #15695
>>12290935 #15690, >>12291934 #15691, >>12292752 #15692
>>12289414 #15688, >>12290161 #15689, >>12290935 #15690
>>12287103 #15685, >>12287869 #15686, >>12288625 #15687
>>12284759 #15682, >>12285578 #15683, >>12286420 #15684
>>12282195 #15679, >>12282927 #15680, >>12283924 #15681
Notables Aggregators: https://wearethene.ws & https://qnotables.com
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
8d25df No.12310781
QRMemes: Social Media Warfare Armory
>>>/qrmemes/ ————————————–——– New One-stop Meme Board, organized by topic
archive.is/hogSX ————————————–——– Digital Camo Thread Archive
Other Dedicated Research Threads
>>9901078 ————————————–——– Questions & Practice Thread
>>11039643 ————————————–——– Clockwork Qrange #11
>>>/qrb/13005 ————————————–——– Planefagging 101 Q&A
>>>/qrb/42185 ————————————–——– Boatfagging Q&A
International Q Research Threads
>>12076528 ————————————–——– Australia #12
>>11995326 ————————————–——– Balkan #2
>>11581748 ————————————–——– Brazil #1
>>12053898 ————————————–——– Canada #11
>>11250635 ————————————–——– China #1
>>8331823 ————————————–——– France #2
>>12145439 ————————————–——– Germany #73
>>10838222 ————————————–——– Italia #1
>>11487786 ————————————–——– Israel/Zionism #1
>>12219245 ————————————–——– Japan #1
>>9133907 ————————————–——– Mexico #1
>>10497699 ————————————–——– Nederland #5
>>10524823 ————————————–——– New Zealand #5
>>5290557 ————————————–——– Nordic #1
>>11937308 ————————————–——– Scotland #2
>>11550704 ————————————–——– South Africa #2
>>12196203 ————————————–——– UK #28
>>11306246 ————————————–——– Vatican #2
Q Proofs
>>6156082 ————————————–——– Q Proofs Threads, Proofs of Q's Validity
QProofs.com ————————————–——– Website dedicated to Q Proofs
Book of Q Proofs ————————————–——– https://mega.nz/#F!afISyCoY!6N1lY_fcYFOz4OQpT82p2w
Q Happenings Calendar
Submit an Event ————————————–——– https://teamup.com/ks8x4ixptej432xt2a
Main Calendar URL ————————————–——– https://dark-to-light.org/calendar/
Resignations
Website ————————————–——– https://www.resignation.info
Sealed Indictments
Sealed Indictment Master: https://docs.google.com/spreadsheets/d/1kVQwX9l9HJ5F76x05ic_YnU_Z5yiVS96LbzAOP66EzA/edit#gid=1525422677
Sealed Indictment Master Files Backup: https://drive.google.com/open?id=1iBS4WgngH8u8-wAqhehRIWCVBQKD8-5Y
Searchable Indictment Map w/Dockets, Links & More: https://bad-boys.us/
Board Admin & Discussion Threads
>>11716920 ————————————–——– META (for board admin queries)
>>11728868 ————————————–——– Q Research General Dough/Kitchen Meta
Letters of Gratitude
>>1215912 ————————————–——– (Q posted in #1025)
Q Graphics / The MAP - All In GMT
>>11187218 ————————————–——– #001 and scroll down for all continuing in numerical order
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
8d25df No.12310783
QPosts Archives
* QMap & Mirrors PDF:
MEGA: https://mega.nz/#!pjpS1aBI!LwepOu-CyC4UlLj2dXqkxiH49D813WetrOF0OCuIg1Y
MEDIAFIRE: https://www.mediafire.com/file/xszgdtiow4hups0/Q_Anon_-_The_Storm_-_X.VII.pdf/file
SCRIBD: https://www.scribd.com/document/419874308/Q-Anon-The-Storm-X-VII?secret_password=55SQ1tCYhuNR8ESzm50u
* QPosts Archive, Players in the Game/ Analytics on Q posts & More: qmap.pub
* QPosts Archive, Searchable, interactive with user-explanations: qanon.pub qanon.app (Backup: qntmpkts.keybase.pub)
* QPosts Archive + RSS, Searchable, Analytics, Offsite Bread Archive: qanon.news
* Spreadsheet QPosts Q&A and all images backup: https://docs.google.com/spreadsheets/d/1Efm2AcuMJ7whuuB6T7ouOIwrE_9S-1vDJLAXIVPZU2g
QPosts Archives in Other Formats
* Q Raw Text Dumps: q-clock.com/q_raw.txt
* Expanded Q Text Drops: pastebin.com/dfWVpBbY
* Spreadsheet Timestamps/Deltas: docs.google.com/spreadsheets/d/1OqTR0hPipmL9NE4u_JAzBiWXov3YYOIZIw6nPe3t4wo/
* Memo & OIG Report Links: 8kun.top/qresearch/res/426641.html#427188
* Original, full-size images Q has posted: https://postimg.cc/gallery/29wdmgyze/
QResearch Search Engine
* Search all posts from QResearch: https://qresear.ch/
Tweet Tools
* Deleted Trump Tweets: https://factba.se/topic/deleted-tweets
* POTUS' Tweet Archive: trumptwitterarchive.com
* Twitter Video Downloader: http://twittervideodownloader.com/
Other Tools
* Searchable Commercial Aviation Incident List: http://avherald.com
* Searchable Hussein WH visitor list: https://archive.org/details/WHvisitorlogs_2010-16_date
* Qcode Guide to Abbreviations: pastebin.com/UhK5tkgb
* Q Happenings Calendar 2018: https://mega.nz/#F!KPQiBJiY!dK3XRe4RYoXgWq_85u4-yg
* Legal News: www.justice.gov/usao/pressreleases
* Stock Movement Scraper: http://qest.us (for seeing LARGE movements of $)
* Updated All Google Search Operators: https://ahrefs.com/blog/google-advanced-search-operators/
* Module Retired - Federal Procurement Data System: https://www.fpds.gov/fpdsng_cms/index.php/en/
* Federal Judicial Court dataset from 93 Federal Districts - Searchable db: https://bad-boys.us/
* Catalog of US Government Publications: https://catalog.gpo.gov/F?RN=306384688
* Webpage Archiver: http://archive.md/
* Baker Tools v0.7.3: https://pastebin.com/EDmx2iEr
* Check Criminal Cases: https://www.justice.gov/usao/find-your-united-states-attorney
* Get your Q clocks anytime (0 - 59 min past posts): https://q-clock.com
Bread Archives (sites)
Board Archive - The main /research/ board archive: https://8kun.top/qresearch/archive/index.html
Offsite Archive - qanon.news/archives
Bread Archives (downloads)
MasterArchivist qarchives.gq | masterarchivist.github.io/qarchives/
Supplement to MA main spreadsheet, 2nd tab (labeled)
Germanarchiveanon https://mega.nz/folder/LPZxEIYJ#N5JwCNoxOxOtAoErKdUgvw
Missing Catalog Bredz 10964-11007 https://pastebin.com/xT0PWKMf
https://docs.google.com/spreadsheets/d/1M2AzhZKh2PjL7L7GVPN42Em0hZXKWMdhGnj59ZQ3YcQ/edit#gid=0
Learn To Bake!
Quick Pic Bake Instructions & simple instructions: >>>/qrb/10809, https://pastebin.com/aY5LyDPY
Baker templates for formatting crumbs plus links: https://pastebin.com/36a1EXpR
Iwo Jima videos: https://youtu.be/5zezIBBxjEs, https://www.youtube.com/watch?v=MLCupx1UExg
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
8d25df No.12310788
Dough
https://controlc.com/68bfa89c
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
fd817c No.12310816
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
127ae9 No.12310834
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
fd817c No.12310838
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
c94518 No.12310840
Jeremiah 1:19
They will fight against you but will not overcome you, for I am with you and will rescue you,” declares the Lord.
Jeremiah 29:11
For I know the plans I have for you,” declares the Lord, “plans to prosper you and not to harm you, plans to give you hope and a future.
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
92e640 No.12310848
>>12293544 /pb
>>>12289550 “U.S. officials are reportedly privately worried Russia stole blueprints for U.S. blackout restoration
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
dcb9e0 No.12310860
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
130660 No.12310863
Why are they trying to call in the National Guard on protesters for the 5th and 6th? Do they think the protesters will try to storm the reichstag and hang all the traitors or something?? Lmao wtf!
These people are just plain silly!
Silly I tell ya!
https://twitter.com/disclosetv/status/1346131667560378371
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
dcb9e0 No.12310870
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
6050a9 No.12310872
Lin wood hasn't said anything we haven't heard before. Not sure what the big revelation is here.
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
6c4a2e No.12310873
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
dcb9e0 No.12310877
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
327eab No.12310881
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
666a80 No.12310882
>>12310788
TYB
so how many plainclothes LEO, mil, etc. 3-letters in D.C. Wednesday?
don't be stupid, anons.
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
385563 No.12310883
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
fd75bf No.12310884
>>12310838
https://en.wikipedia.org/wiki/Elagabalus
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
65da4c No.12310885
Russia now probing case of helicopter downed by Azerbaijan as murder -Interfax
MOSCOW (Reuters) - Russian military investigators are now treating the Nov. 9 downing of a helicopter over Armenia as "wilful murder", a more serious charge than the previous "death through negligence", Interfax news agency reported on Monday, citing a source.
A Russian Mi-24 helicopter was shot down over Armenia near the border with a region belonging to Azerbaijan, killing two crew members and injuring another, just few hours before a Moscow-brokered peace deal over Nagorno-Karabakh was reached.
Heavy fighting between Azerbaijan, which has the political backing of Turkey, and ethnic Armenian forces over the mountainous region had been raging for six weeks at the time of the incident.
Azerbaijan's Foreign Ministry said Azeri forces shot down the helicopter by accident, expressing apologies to Moscow and a readiness to pay compensation.
Interfax said on Monday, citing the source, that a case had initially been opened into a potential infringement of flying regulations that had resulted in deaths through negligence.
The reported switch to a murder charge, which could lead to a sentence of life imprisonment for those held responsible, may complicate relations between Moscow and Azerbaijan.
The conflict has tested Moscow's influence in the South Caucasus, a swath of the former Soviet Union it views as vital to defending its own southern flank.
https://www.yahoo.com/news/russia-now-probing-case-helicopter-142001553.html
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
ef5c37 No.12310886
Extraordinary warning to Trump by 10 former Pentagon chiefs
“The time for questioning the results has passed,” they wrote.
WASHINGTON — In an extraordinary rebuke of President Donald Trump, all 10 living former secretaries of defense are cautioning against any move to involve the military in pursuing claims of election fraud, arguing that it would take the country into “dangerous, unlawful and unconstitutional territory.”
https://www.nbcnews.com/politics/white-house/extraordinary-warning-trump-10-former-pentagon-chiefs-n1252704
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
dcb9e0 No.12310887
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
3bb08e No.12310888
Qua non needs a spine today.
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
870559 No.12310889
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
5a98bb No.12310890
>>12310886
>former Pentagon chiefs
one of those words is important.
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
07d1f1 No.12310891
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
ef5c37 No.12310893
https://www.theepochtimes.com/exclusive-over-432000-votes-removed-from-trump-in-pennsylvania-data-scientists-say_3642202.html
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
dcb9e0 No.12310894
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
2ec61d No.12310895
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
aee2a0 No.12310896
>>12309477
>>12309477 PB
>In regards to Lin Wood, let's analyze a few points:
>A. He is stating that Chief Justice Roberts adopted his children through Epstein.
>B. Chief Justice Roberts adopted his children for a pedophilia sacrifice.
>C. Lin directly asks Roberts if he is a member of a cabal that requires minor children as an initiation fee.
>D. He claims that Roberts discussed Scalia's death before it occurred.
>E. It is stated that with absolute certainly that Epstein is still alive and cooperating.
>His claims acknowledge that there is a cabal that requires pedophile acts in order to be apart of their group. The Chief Justice of the Supreme Court is a part of these cabal and sacrifices his own adoptive children to be apart of this group. This group is so powerful that they are able to kill a supreme court justice. With only reviewing what Lin Wood is stating, he would be murdered just for even simply alluding to all of this. He basically just signed his death warrant. I don’t believe that Lin has a death wish, he knows what he just exposed puts a giant target on his back. The only rational explanation for his statements is that this cabal is no longer a threat, and the patriots are in control, and are about to Cross the Rubicon.
You cannot assume Patriots are in control by this. Never assume that. So many have died trying to uncover these truths and just know that the only protection he has were the keys of encryption and KAPPY had those keys, ASSANGE, etc and they are not protected! The tentacles are thousands and there is no way that protection is guaranteed.
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
518715 No.12310897
>>12310872
First time this is pronounced by someone with Nationwide name recognition on social media and hasn't been censored.
So either it is true, or disinformation the cabal wants spread around.
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
b0b660 No.12310898
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
f56d94 No.12310899
>>12310872
The Precipice doesn't allow for much to cheer about so many have to take solace in whatever they can.
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
3bb08e No.12310901
>>12310863
guard comp'd? of course, they're all masons, right? doctors, local guys?
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
e34828 No.12310902
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
dcb9e0 No.12310903
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
f5d86c No.12310904
>>12310834
>>12310377 lb
Here's my thought regarding this
"gun to rape/gun to kill" tweet
Lin posted last night/early this morning.
Up to this point, the whole "blackmail"
thing seemed like it was a
CAUGHT IN THE ACT type of blackmail.
So, all this pedocrap going on were with
total scumbags who were doing it
just because they could and someone
had a hidden cam then showed
'em the GOTCHA tape and that's it.
Handled and controlled.
Now, with Lin's "revelation", it comes
across as
COERCED IN THE ACT blackmail where
their defenders could say it was
AGAINST THEIR WILL/UNDER DURESS
type of crap and a segment of the
un-awakened genpop will have their
empathy switch FLIPPED ON and the
FEEL SORRY FOR THEM factor will
kick-in for those "being" blackmailed into
it.
Which, in their eyes will now look like VICTIMS!
Victims my ass.
So, there better be distinctions and
CLEAR LINES DRAWN and
WHOLE PICTURES PAINTED of
who's who and what's what!
Don't tell me the Lolita Island hoppers
were there because they were
FORCED TO BE THERE at gunpoint.
Same with the PODESTA PIZZAGATE
PARTY PEDOS.
Fuck dat shit. Ain't no way, motherfucker!
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
4470a2 No.12310905
JOHN CARDILLO IS UNHINGED BECAUSE OF LIN WOOD
The new narrative is, "if you call out lunacy, you're jealous of the lunatic."
https://twitter.com/johncardillo/status/1346134634598440965
And his reply to someone
Lin Wood is not uncovering anything. And the numbers on the missing kids is wrong. Most are runaways who are quickly recovered.
https://twitter.com/johncardillo/status/1346135909939478530
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
89d978 No.12310906
>>12310863
Democrats call in the NG on Trump supporters but let Antifa tear down statues and burn churches down wtf kind of sense does that make??
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
a1b27b No.12310908
Q#4881
Q !!Hs1Jq13jV6 10/17/2020 12:36:26
https://twitter.com/stinchfield1776/status/1317450311192223746
There is 'Q'. 1
There are 'Anons'. 2
There is no 'Qanon'. 3
Media labeling as 'Qanon' is a method [deliberate] to combine [attach] 'Q' to comments _theories _suggestions _statements [and ACTIONS] made by 2.
WHAT HAPPENS WHEN YOU CANNOT ATTACK THE INFORMATION [primary source 1]?
DO YOU ATTACK [& TYPECAST] THROUGH USE OF OTHERS?
Not all 'Anons' are authentic [injected].
You are correct, CJ.
Retweet @ 17:17 had meaning. [mathematical probability _17:17 [day after]?]
Do you believe it was a coincidence surgical removal of You Tube accounts occurred same day as 'Hunter' drop?
Welcome to the Digital Battlefield.
Q
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
a29ff6 No.12310909
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
385563 No.12310910
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
cb893e No.12310911
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
65da4c No.12310912
>>12310886
They are putting out Fear of the MIL ahead of what's coming.
That is Mutiny.
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
edaf99 No.12310913
>>12310863
Still trying to convince the world it was Trump supporters who were violent on those days…scare tactic also to deter supporters from showing up.
Trump supporters marched from Freedom Plaza to the Supreme Court Building, across from the Capitol, during the day. Their activities and those of counterdemonstrators grew increasing tense and took a violent turn in the early evening. Videos posted to social media showed numerous incidents of shoving and punching as well as a fireworks explosion and a man shoving and knocking down one person before being shoved and punched unconscious himself by others.
https://apnews.com/article/nearly-2-dozen-arrested-trump-protests-2f5cfab681cf0bbee785fcc1a4209701
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
f8a88a No.12310914
Bobby Piton insinuating a fake MSM hit piece coming out on him
BobbyPiton
@BobbyPiton3
Just got off the phone with a reporter (possibly MSM) That said, in IL it is against the law to record a conversation without permission. For the record, I did not grant permission to record my conversation. Since this is the case, I write up everything I discussed and share
10:32 AM · Jan 4, 2021·Twitter Web App
435
Retweets
9
Quote Tweets
1.4K
Likes
https://twitter.com/BobbyPiton3/status/1346117302719275010?s=20
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
fd75bf No.12310915
>>12310911
blonde didn't trust you, he's still gonna give you your part
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
dee259 No.12310916
>>12310872
>Lin wood hasn't said anything we haven't heard before. Not sure what the big revelation is here.
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
3f3bcd No.12310917
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
dcb9e0 No.12310918
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
04a674 No.12310919
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
518715 No.12310920
>>12310893
All you need to do is watch the replay of live fox broadcast to see the Trump Numbers actually go down after a count is reported.
They showed their theft in full view, but they are all so compromised, that even full evidence is not enough to force a narrative change.
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
fe08ec No.12310921
Planefag update:
KC135 over Oak Ridge with 2 Navy jets doing DefPats.
Possible threat against Oak Ridge by Iran?
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
dcb9e0 No.12310922
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
e34828 No.12310923
>>12310872
Hopefully he's building up to aliens and breeding programs.
That should really piss them off.
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
4470a2 No.12310924
>>12310905
Forgot pics of tweets, kek sorry
Still waking up
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
55dc86 No.12310926
>>12310886
>10 former Pentagon chiefs
Ah, so those who were collectively in charge of the Pedo Pentagon? Gotcha.
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
e2f0c4 No.12310927
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
49fc32 No.12310928
>>12310872
Twat is a social media platform for normies, and is not a back channel. He is getting normie eyes on it to wake up those he can, but more importantly this puts the fact that he has the dirt into the spotlight. Will hopefully provide a modicum of protection that others who have tried to expose this shit have not had.
He is forcing the dark out into the light -
This also is a way to establish a public 'chain of custody' for the info so it doesn't look like POTUS pulled it out of his ass to smear political opponents
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
127ae9 No.12310929
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
abd828 No.12310930
>>12310239 (LB)
Who gave the order to stand down?
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
044b31 No.12310931
>>12310916
Cocaine is a hell of a drug.
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
dcb9e0 No.12310932
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
aee2a0 No.12310933
>>12310904
Stop typing please
They can only coerce you to do that if you are already corrupt to begin with
An incorruptible person would never be in that position
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
1c13b5 No.12310934
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
f508dd No.12310935
>>12310788
Thank you, Baker!
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
9cb40c No.12310936
>>12310788
Bowser calling in the Koopa Troopas to deal with millions of red-hat Marios chanting MAGA? It's doesn't get much more Nintendo than that.
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
2bc6de No.12310937
>>12310909
Excellent reply.
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
ba7d7e No.12310939
>>12310908
>You are correct, CJ.
who the fuck is cj?
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
6050a9 No.12310940
>>12310897
I would definitely put him in the cabal territory.
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
3bb08e No.12310941
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
fd75bf No.12310942
>>12310926
the pentagon always does things times 3 1/3 so . . . 10 former Chief equals Three Blind Mice in real world terms.
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
a29ff6 No.12310943
>>12310927
She needs to get her ass of the counter
get the bleach
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
1c13b5 No.12310944
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
dcb9e0 No.12310945
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
f5d86c No.12310946
>>12310927
Man those legs look inviting!
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
91b08e No.12310947
>>12310863
National Guard will have to make a choice. They are on the precipice too
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
3bb08e No.12310948
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
4d6d88 No.12310949
>>12310916
Lin Wood just throws out allegations with no proof.
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
518715 No.12310950
>>12310873
Sorry, Q is gone fishing
But nice catch anon
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
4c76f7 No.12310951
>>12310863
"no DCNG personnel shall be armed during this mission…"
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
aee2a0 No.12310952
>>12310924
Time to start looking into John Cardillo
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
7dbde4 No.12310953
>>12310899
The Precipice refers (in my opinion) to the waking of the people.
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
127ae9 No.12310954
YouTube embed. Click thumbnail to play. >>12310863
This is how you March into battle. Massive numbers, armed to the teeth, singing your heart out.
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
385563 No.12310955
>>12310946
dig, meme, pray!!!!!!!!!!!!!!!!!!!!!!!!!!
kek
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
dcb9e0 No.12310956
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
4470a2 No.12310957
>>12310917
I noticed that too
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
666a80 No.12310958
doesn't the head of Joint Chiefs of Staff act as Governor for D.C.
in all Title 32 vs. Title 10 matters?
"under the guise of riot control"
no mention of vax dispersal
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
5af0a0 No.12310959
>>12310863
3 or so million pissed off americans in DC while Congress gives American people 100 Billion in covid relief but then gives 700 Billion to other countries and gives away American jobs with recent unlimited cap to H1-B… I mean what could possibly go wrong??
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
ef5c37 No.12310962
Trump phone call: Democrats ask FBI for ‘immediate criminal investigation’ in new letter
https://www.independent.co.uk/news/world/americas/us-election-2020/trump-phone-call-fbi-georgia-b1782130.html
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
3bb08e No.12310963
>>12310872
he sure draws lots of shills for doing merely that, doesn't he.
reconcile.
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
4e68dd No.12310964
Lets open the Clinton/China can of worms.
https://www.thegatewaypundit.com/2017/11/ex-clinton-foundation-exec-linked-chinese-kindergarten-investigation-alleged-child-molestation/
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
e18083 No.12310965
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
fd75bf No.12310966
Last night I read the story of how it's always windy beside a certain church in Rome . . .
interesting story the wind was told to wait for the Devil, as they were travelling together.
this is supposed to have happened a long long time ago, the Devil went into the church because he had a meeting with the Je su its in dare.
well The Wind is still waiting for that meeting to conclude.
from Secret Rome, a small tome worth a read
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
dcb9e0 No.12310967
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
aee2a0 No.12310968
>>12310949
He gave you proof and the proof has been out there since the first pizzagate drop in 2015. Nice try but fuck off.
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
9cb40c No.12310969
>>12310872
Public recognition. Permeating the surface.
>>12310909
Well, anon's right. How does the public feel about Lin's tweets? I just talked to someone that has no clue who Lin is. Until people on the other side start reporting this stuff, we are still waiting for more mainstream saturation.
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
18728d No.12310970
>>12310909
Mark it 9, Dude.
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
3bb08e No.12310971
>>12310965
Pute Pepe BACK in.
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
ba7d7e No.12310972
>>12310863
That's the head scratcher.
The NG's have demonstrated that they will not touch real protesters, and will arrest rioters.
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
6c4a2e No.12310973
It’s a Planned Panic-demic.
It’s amazing what your own brain can do to you’re body while wrapped in fear. Keep filling people with propoganda their bound to stress their immune system into getting something. And despite the reports, covid didn’t kill ask other forms of death like a vicious monster virus. You probably got a cold.
Covid hoax
Johns Hopkins study explodes COVID death hoax; it’s re-labeling on a grand scale
https://canadafreepress.com/article/johns-hopkins-study-explodes-covid-death-hoax-its-re-labeling-on-a-grand-sc
https://archive.vn/Evla0
“only 6% of all coronavirus deaths were completely due to the coronavirus alone” cdc quietly reports
https://www.thegatewaypundit.com/2020/08/shock-report-week-cdc-quietly-updated-covid-19-numbers-9210-americans-died-covid-19-alone-rest-serious-illnesses/
https://archive.vn/JZNnm
But 3 million usa covid deaths in 2020!
https://archive.vn/j0V2g
Death by lightning, I mean covid.
https://archive.vn/dNWm6
Swedish death toll + change in death rates images
https://i.maga.host/fn9Vvql.png
https://i.maga.host/I2nvJgu.png America numbers
https://i.maga.host/ZtiGDth.png
No need covid gone (If it ever actually existed to begin with) https://www.lifesitenews.com/news/former-pfizer-vp-no-need-for-vaccines-the-pandemic-is-effectively-over
https://archive.vn/i8kNw
4.Antibodies wont last long enough? Antibodies last weeks. https://www.miamiherald.com/news/coronavirus/article244087867.html
https://archive.vn/YjUob
Antibodies?
28 days later:
https://www.outlookindia.com/website/story/world-news-moderna-vaccine-helps-antibodies-stay-active-for-90-days-reports/366157
https://archive.vn/09alU
Heard immunity unethical?! Johnson and johnson pause trials (unexplained illness)
https://www.infowars.com/posts/johnson-johnson-pauses-late-stage-covid-19-vaccine-trial-after-volunteer-becomes-sick/
https://archive.vn/WStO1
Who changes definition of herd immunity to mean vaccines
https://i.maga.host/2lIJ3Zq.png
Antibody passports? Pandemic expected for at least another year
https://worldisraelnews.com/israel-announces-green-passports-for-covid-19-recoverees-pandemic-expected-for-at-least-another-year/
https://archive.vn/V4k54
Death numbers would be so bad if medicinal people weren’t purposefully storing the deaths by killing the elderly “covid” patients. Euthanasia https://www.thesun.co.uk/news/12100515/care-homes-accused-sedatives-coronavirus-die-quickly/
https://archive.vn/27LqA
Where is the isolated virus?
https://www.lewrockwell.com/2020/12/jon-rappoport/the-sars-cov-2-virus-was-never-proved-to-exist/
https://archive.vn/WWKP2
Why sell out? Pfizer ceo sells most shares say vaccine launch.
https://financialpost.com/financial-times/why-the-pfizer-ceo-selling-62-of-his-stock-the-same-day-as-the-vaccine-announcement-looks-bad
https://archive.vn/nJzgJ
And Moderna too
https://www.bnnbloomberg.ca/moderna-chief-sells-more-shares-ahead-of-urgent-vaccine-filing-1.1526465
https://archive.vn/QXwaq
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
088e17 No.12310974
Jack Benny: Remain United.
hold the line, frens
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
870559 No.12310975
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
404b7b No.12310976
>>12310872
>Lin wood hasn't said anything we haven't heard before. Not sure what the big revelation is here.
The info has to be slowly fed to the public, otherwise it will be rejected.
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
666a80 No.12310977
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
5a98bb No.12310978
>>12310924
Worldwide the number of missing reaches near 8 million annually, over 90% of which are women and children.
Even if 1% of those are victims of human trafficking, that's 220 a day that are sold into human trafficking rings.
That's a real fucking problem.
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
7b1d05 No.12310979
>>12310890
Hmm.
You change the res on this?
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
1e91c9 No.12310980
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
252c00 No.12310982
>>12310949
Are you involved with the blackmail scheme?
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
cb893e No.12310983
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
9cb40c No.12310984
>>12310939
CJ Truth from twitter.
https://twitter.com/cjtruth/
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
f5d86c No.12310985
>>12310933
I'll tell you what.
DON'T tell me to stop typing
and I won't tell you to FUCK OFF!
Howbowdah dickwad?!
In MY PART of this board,
the FIRST AMENDMENT rides
HIGH and LOUD.
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
8d25df No.12310987
Notables Are Not Endorsements
#15715
>>12310914 Bobby Piton insinuating a fake MSM hit piece coming out on him
>>12310905, >>12310924 John Cardillo is unhinged because of Lin Wood
>>12310973 It’s a Planned Panic-demic.`
>>12310921 pf
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
dca983 No.12310988
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
3bb08e No.12310990
>>12310965
there are no autists
and only a few anons
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
2424f2 No.12310991
>>12310788
Thank You Baker!
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
a29ff6 No.12310992
>>12310969
>I just talked to someone that has no clue who Lin is
And it's YOUR JOB to inform them
smdh
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
ba7d7e No.12310993
>>12310984
>https://twitter.com/cjtruth/
oh, ok. they suspended now
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
4d6d88 No.12310994
>>12310968
I've seen no video of anyone shooting a kid.
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
bc083b No.12310995
>>12310709 (lb)
>>12310761 (lb)
On his third low pass, wtf fuck is up here
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
af472d No.12310996
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
4b1a9a No.12310997
>>12310872
Are you retarded?
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
18728d No.12310998
>>12310949
A famous defamation lawyer wouldn’t say shit unless he can fully back it. The slow drip is starting to flow faster.
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
088e17 No.12310999
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
ebc401 No.12311000
Lucian Lincoln "Lin" Wood Jr.
https://na.leagueoflegends.com/en-us/champions/lucian/
Lucian, a Sentinel of Light, is a grim hunter of undying spirits, pursuing them relentlessly….
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
c960aa No.12311001
99.9% of humanity was assimilated into a hivemind three months ago.
No one really noticed.
Only now, the 0.01% are starting to put the pieces together
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
385563 No.12311002
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
9cb40c No.12311003
>>12310992
Can't inform people that don't want to listen. I'm sure the plan has something in store for those folks, too, right? Anon does his part; trust me.
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
8bd541 No.12311004
YouTube embed. Click thumbnail to play. Georgia Sec. of State discusses phone call with Trump about election results l GMA
“For the last two months, we’ve been fighting a rumor whack-a-mole. It was pretty obvious very early on that we debunked every one of those theories, but President Trump continues to believe them.” “Everything we’ve done for the last 12 months follows the constitution of the state of Georgia, follows the United States Constitution, follows state law.”
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
1c13b5 No.12311005
My local news at noon just opened with the tape of Trump, describing it as him "begging Raffensperger to change election results."
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
ba7d7e No.12311006
>>12310788
it's been a while.
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
8d25df No.12311007
Shadow strike.
A @usairforce
F-15E Strike Eagle prepares to continue its mission after refueling from a KC-135 Stratotanker over Southwest Asia.
https://twitter.com/DeptofDefense/status/1346139332969525249
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
f08cb6 No.12311008
>>12310993
>>12310993
Suspended CJ a couple weeks ago on Twitter. But he is still active on Gab and Parler
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
b02bb8 No.12311009
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
4470a2 No.12311010
https://twitter.com/DeptofDefense/status/1346139332969525249
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
50fd09 No.12311011
>>12310886
> by 10 former Pentagon chiefs
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
f56d94 No.12311012
>>12310969
Many I talk to know shit's fucked up, but just don't think anything will be done about it.
Blackpills have never been more popular.
So, while it's nice to see Lin and others putting it out on the line, it's basically reached the point where some action needs to take place in order to get the redpills flowing again.
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
c6cd29 No.12311013
>>12310848
mind your Qs & Ps,
soli luna,
rule of two,
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
4d6d88 No.12311014
>>12310982
Nope, but where is the physical evidence?
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
252c00 No.12311015
To you fuckers that hurt the innocent for personal gain. Mother fuckers like me are out here waiting for the proof.
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
dcb9e0 No.12311016
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
a29ff6 No.12311017
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
42e15f No.12311018
YouTube embed. Click thumbnail to play. All assets deployed.
Lin has really struck a nerve. Do you midwits really think you will be able to change the narrative here?
KEK
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
1ed846 No.12311019
Meanwhile in CA…
https://twitter.com/washingtonpost/status/1346069136519159814
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
088e17 No.12311020
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
696780 No.12311021
R10153 at a Coastal Station close to Cherry Point. Two more 'X' C-30J flights out of Dyess.
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
4dce7a No.12311022
>>12310920
>They showed their theft in full view, but they are all so compromised, that even full evidence is not enough to force a narrative change.
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
1a7844 No.12311023
>>12310906
Go deeper with those thoughts, anon. What does that tell you?
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
a1b27b No.12311024
>>12310939
No idea. I thought it was maybe the nickname for Grant Stinchfield, but he never mentioned '17:17' being a notable.
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
f56d94 No.12311025
>>12310976
>slowly fed
That's nice but 1/20 is right around the corner.
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
a29ff6 No.12311026
>>12311015
>Mother fuckers like me are out here waiting for the proof.
mofos like you are just fucking DUMB.
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
f08cb6 No.12311027
>>12310886
Yeah, NBC, don't be writing that "living" part of these traitors in stone.
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
4c76f7 No.12311028
>>12310904
It looks like a tangled shit pile of all of the above. If it's on tape it has the same effect no matter how it got there. Q said some were forced into bed with evil and that others were already there.
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
23434a No.12311029
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
4470a2 No.12311030
>>12310994
Thats because…
ITS AGAINST US LAW TO POST VIOLENCE AGAINST CHILDREN
Fuckstick
Use your brain.
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
949102 No.12311031
>>12311005
Yeah they are all over that section of the tape. Desperate. And why? Do they think he isnt actually going anywhere? Pics related.
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
af7243 No.12311033
>>12310914
He's a dumbass for even talking to them.
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
c5a8a2 No.12311034
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
349a29 No.12311035
>>12311004
> “Everything we’ve done for the last 12 months follows the constitution of the state of Georgia, follows the United States Constitution, follows state law.”
lying mofo!
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
e2f0c4 No.12311036
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
748849 No.12311037
>>12310863
National Guard will be there at the imagnary Biden inauguration also.
Soon, thousands of National Guard members will descend upon Washington, D.C. to begin preparing to support the 59th presidential inauguration of President-Elect Joe Biden.
So far, Army and Air Guard commands from nearly 30 states have pledged to support what has become a huge tradition for the citizen soldiers.
https://www.military.com/daily-news/2021/01/02/thousands-of-national-guard-troops-prepare-support-bidens-inauguration.html
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
4dce7a No.12311038
>>12311023
>What does that tell you? >>12311022
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
546cb4 No.12311039
Just like the deep state is taking full advantage of COVID-19, /our guys/ should do the same.
HINT: Check Q's first post ever and think what is very easy to do now compared to pre COVID-19 world.
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
5a98bb No.12311040
>>12310979
here have the whole thing
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
0e80d5 No.12311041
Some of this is less than urgent
I want it down though, for the record
>>12309227 pb
Well that's a good thing
F - U to the Deep State.
Now all the Clinton emails and the rest that has been disclosed can be perfectly valid journalistic FREEDOM OF SPEECH with documentation.
and not some "Stolen in the Night" forgeries
Screw you Hillary, if you're even still alive
>>12304558 pb
"good cia officer,
good for whom, for Britain?
Sounds like an oxymoron
Also, SO THEY ADMIT THEY'RE in the secret agent business.
Is that why the FF's have to create an enemy?
>>12304589 pb
just looking at it this morning checking it again
STAGED SHOT
Those severed beams adroitly placed next to the human figures in the foreground
2 of them only
Are meant to suggest Themite / Thermate which was pushed by the controlled "Truth movement"
Could be even a shoop job ith the foreground.
Thermite / Thermate isn't the answer and that's why it's pushed so hard.
They started with Thermite; and when that wa show to be a DUD - can't explain the forensics; then they moved to Thermate, hopeing peeps would be bamboozled and agree with the sold out "engineers" that Thermate could explain
I hope they have to give back ten times the suffering they created
But do Psychopaths suffer?
They need to be outed publicly. No more "We won't tell"
"think of the families"
Now it's not about the families of thevictims who WOULD want to know the truth
ITS ABOUT THE FAMILIES OF THE PERPS
"PLEASE DON'T TELL, WHY MAKE OUR FAMILIES SUFFER bOO HOO
AND THAT S THE WHOLE BUSINSESS OF "let them retire with grace, have a noble funeral"
FUCK THAT
they need to be outed
Thank-yous to Lin S. for understanding who the real victims; and who fights for the real victims and not for the "family members" of the PERPS
BOO HOO
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
d39445 No.12311042
>>12310994
Seems like something like that would have leaked at some point, especially dealing with celebrities, politicians, etc.
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
385563 No.12311043
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
aee2a0 No.12311044
>>12310994
I’ve seen no evidence that you bothered to do any reading of the evidence he posted nor have you gotten off your lazy ass and did any research or critical thinking
Fucking lazy ass retard is what you are
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
a1b27b No.12311045
>>12310964
Didn't Q drop a post of a tall guy in Hong Kong, alluding to children?
Same guy who was wearing red shoes in another pic Q dropped?
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
6d5d25 No.12311046
>>12311010
Twelve O'Clock High
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
a118fd No.12311047
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
0e80d5 No.12311048
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
dcb9e0 No.12311050
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
1c13b5 No.12311051
>>12311031
"Criminal election tampering." kek
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
3bb08e No.12311052
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
6050a9 No.12311053
>>12310997
No. I can get better info on a Google search.
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
9eaf72 No.12311054
>>12310863
Bowser needs to beware what she wishes for. She might not get the NG deployment she wants.
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
56c68e No.12311055
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
e5ddbb No.12311056
YouTube embed. Click thumbnail to play. A physics lesson on the MODES of heat transfer and why all modes obey the same basic principles, such as heat flowing from hot to cold only.
Also discussed is the strange situation climate science academia finds itself in today, with its believing in and active support of total pseudoscience.
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
c960aa No.12311057
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
40927e No.12311058
>>12310905
Cardillo:DONT LOOK HERE, LOOK THERE
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
ae69bb No.12311059
Ultra stealth MAGA Patriots…
Stealth drones that the government developed don't even know are in the MAGA Patriots hands… Why because their fathers left this technology for urban warfare.
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
a29ff6 No.12311060
>>12311037
the NG will be there to restore law & order and protect the POTUS. Donald J. Trump.
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
4e68dd No.12311062
Can we start stacking bodies yet? Asking for a nation…
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
b0b660 No.12311063
>>12311019
Death rate inflated much. Kek
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
65da4c No.12311064
>>12311004
Last two months, we've been fighting the rumor of Whack a Mole?
Awww, don't you know who the mole is?
Not sure who RATTED you out RATTBURGER?
Could have picked a better Zoom Background that one is kind of CHEESEY. Pillows look like Rabbits…
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
55dc86 No.12311065
>>12310979
https://breakthematrix.com/blog/breaking-vice-video-shows-christchurch-shooting-victim-checking-facebook-status-watch/
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
8bd541 No.12311066
>>12311035
Thinking..he's too far gone now..he has to stick to his story. He already knows it doesn't matter for him either way..he goes down..nothing can stop what the future holds for him in Gitmo.
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
ad03d0 No.12311067
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
d39445 No.12311068
>>12311054
They were going to be there anyway, just not for her.
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
1ed846 No.12311069
Biden Promises Nationwide Mask Mandate And Womandate
https://twitter.com/TheBabylonBee/status/1346131807985692674
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
e34828 No.12311071
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
286c63 No.12311072
Fake news is spewing the narrative that what the R Senators and others are doing, those who will dispute the electoral count, is UNDEMOCRATIC.
They don't ever say that what they are doing is UNCONSITUTIONAL…
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
ec5417 No.12311073
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
4d6d88 No.12311074
>>12311044
The normies do not have time for that. They need physical proof shown to them. Where is it? not just some creepy pictures that insinuate something.
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
c55e5a No.12311075
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
dcb9e0 No.12311076
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
ba7d7e No.12311078
>>12311064
something something hoisted… petard…
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
91b08e No.12311079
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
49fc32 No.12311080
Moving the Overton window on COVID?
Cheap hair lice drug may cut risk of COVID-19 death by 80 percent: study
https://nypost.com/2021/01/04/hair-lice-drug-may-cut-risk-of-covid-19-death-by-80-percent/
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
163a98 No.12311081
>>12310863
Why do the old timers call the NG the ‘pappy shooters’? What does that mean??
Are Dems trying to have to NG hurt or kill protesters??
Wtf..
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
022f3c No.12311082
>>12310998
or, he knows exactly how much he can say and still stay out of court.
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
a1b27b No.12311083
>>12311037
>https://www.Military.com
https://who.is/whois/military.com
CSC CORPORATE DOMAINS, INC.
ALL (DISINFO) ASSETS DEPLOYED
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
cd1184 No.12311084
>>12310914
Bobby Piton
interdasting fact….
pi·ton
/ˈpētän/
noun
a peg or spike driven into a rock or crack to support a climber or a rope.
Movie
Bobby is a 2006 American drama film written and directed by Emilio Estevez, and starring an ensemble cast featuring Harry Belafonte, Joy Bryant, Nick Cannon, Laurence Fishburne, Spencer Garrett, Helen Hunt, Anthony Hopkins, Ashton Kutcher, Shia LaBeouf, Lindsay Lohan, William H. Macy, Demi Moore, Martin Sheen, Christian Slater, Sharon Stone, Freddy Rodriguez, Heather Graham, Elijah Wood and Estevez himself. The screenplay is a fictionalized account of the hours leading up to the June 5, 1968, shooting of U.S. Senator Robert F. Kennedy in the kitchen of the Ambassador Hotel in Los Angeles following his win of the 1968 Democratic presidential primary in California
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
f5d86c No.12311086
>>12311019
Here we go.
Which round of COVID are we on now?
3rd?
4th?
California cocksuckers!
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
95d7d9 No.12311087
>>12310983
Eli might want to back down before it’s too late
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
e34828 No.12311088
>>12311043
Come on man, I'm losing a lot of blood over here
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
f8a88a No.12311089
https://twitter.com/ScottAdamsSays/status/1346093264642818053?s=20
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
dcb9e0 No.12311090
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
367d5f No.12311091
>>12311081
>Are Dems trying to have to NG hurt or kill protesters??
* Are Dems trying to have the NG hurt or kill protesters??
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
5a5936 No.12311092
>>12310814 LB
There’s a difference between stupid and ignorant. There are all levels here. Perhaps YOU need to read up on definitions of “chan” and “kun.” If you are so wise, you should be educating the others. Cussing them out is only causing division.
They want us divided.
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
7b1d05 No.12311094
>>12311040
I was up that night on 8chan.
Posted photo of the graffitied rifle (pointed out the little girl's name)
I don't know where I stand with the whole thing now, after having watched many, many vids.
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
2234b7 No.12311095
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
235da0 No.12311096
>>12310789 (last bread)
NOTABLE
>The 1973 Home Rule Act, which granted the District limited autonomous authority, contains provisions for the “emergency control of police” via a federal takeover of the D.C. police.
To invoke that act, the president would have to determine that “special conditions of an emergency nature exist which require the use of the Metropolitan Police force for federal purposes.” The takeover may last up to 48 hours and may be extended with approval of the members of Congress that oversee District affairs, the act states.
https://www.washingtonpost.com/local/public-safety/dc-police-takeover-george-floyd/2020/06/02/856a9744-a4da-11ea-bb20-ebf0921f3bbd_story.html
HINT HINT Boss
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
47cf17 No.12311097
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
2424f2 No.12311098
Congress Approves Rules Regulating Jan. 6 Electoral Vote Count
January 4, 2021
The House of Representatives and the Senate on Sunday adopted rules that outline how the counting of Electoral College votes will take place on Jan. 6.
The rules were passed without recorded votes. Instead, a voice vote was used in both chambers.
The guidance, introduced by Senate Majority Leader Mitch McConnell (R-Ky.), says the chambers will meet in a joint session on Jan. 6 presided over by Vice President Mike Pence.
Pence, as president of the Senate, will open “all the certificates and papers purporting to be certificates of the electoral votes,” the rules state, a nod to how seven states sent so-called competing electors, or certificates for both Democratic presidential nominee Joe Biden and President Donald Trump, to Washington.
The certificates and papers will be opened, presented, and acted upon in alphabetical order, starting with Alabama.
This is when dozens of Republicans—50 representatives and 12 senators, according to an Epoch Times tally—are planning to object to some certificates, alleging election irregularities including voter fraud and failure to follow state election laws.
That will trigger a withdrawal from the joint session and a two-hour debate, followed by votes in each chamber. Only with a majority vote from both the House and the Senate would a challenge be upheld, which even supporters find unlikely, considering Democrats who control the House and Senate Republican leadership, including McConnell, have expressed disapproval with the plan to object.
House Speaker Nancy Pelosi (D-Calif.) in a letter to colleagues on Sunday noted that objections can happen but said, at the end of the day, Biden “will be officially declared the next president.”
“On Monday, we will have a clearer picture of how many state votes will be subject to an objection. Our choice is not to use the forum to debate the presidency of Donald Trump,” she added.
Reps. Ron Estes (R-Kan.), Tracey Mann (R-Kan.), and Jacob LaTurner (R-Kan.) said Sunday they will join in the objections, saying in a statement that several states are “facing serious allegations of voter fraud and violations of their own state law.”
“This action is not taken lightly and comes after extensive study and research. Kansans deserve to know that all legal, and only legal, votes were counted. We hope our actions begin to restore the confidence of tens of millions of our fellow Americans that feel their sacred right to vote is under attack,” they added.
Reps. Jim Jordan (R-Ohio) and Richard Hudson (R-N.C.) also announced Sunday they’ll object.
But seven Republican representatives, including several strong Trump supporters, said they will not join in the effort, and denounced the move.
“Of the six states as to which questions have been raised, five have legislatures that are controlled by Republicans, and they all have the power to send a new slate of electoral votes to Congress if they deem such action appropriate under state law. Unless that happens between now and Jan. 6, 2021, Congress will have no authority to influence the outcome of the 2020 presidential election,” the group wrote in a statement.
“To take action otherwise—that is, to unconstitutionally insert Congress into the center of the presidential election process—would amount to stealing power from the people and the states. It would, in effect, replace the Electoral College with Congress, and in so doing strengthen the efforts of those on the left who are determined to eliminate it or render it irrelevant.”
The weekend saw a flurry of action, with 11 senators following Sen. Josh Hawley (R-Mo.) in announcing they’d join in the objections unless Congress appoints a commission to examine alleged election irregularities. The idea is modeled on the panel formed in 1877 amid a contested election.
Hawley’s Dec. 30 announcement triggered a number of House members to announce their intention to object. The number planning to do so has more than doubled since then.
A segment of Republicans are focusing on Pence’s role in the proceedings. They sued the vice president and asked a court to rule he has the “exclusive authority” to decide between dueling electors.
A judge dismissed the case and an appeals court rejected an appeal.
Pence had asked the court to dismiss the suit but said through a spokesman on Saturday that he supports efforts to challenge electoral votes.
“Vice President Pence shares the concerns of millions of Americans about voter fraud and irregularities in the last election,” Pence’s chief of staff, Marc Short, said in the statement sent to media outlets.
https://www.theepochtimes.com/congress-approves-rules-regulating-jan-6-electoral-vote-count_3642381.html?utm_source=news&utm_medium=email&utm_campaign=breaking-2021-01-04-2
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
ba7d7e No.12311099
>>12311086
The new strain is called covid 5… thousand.
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
07d1f1 No.12311100
>>12310622 lb
>>12310921 lb
OK, I found it
The Blacklist Button
https://8kun.top/qresearch/res/12117594.html#q12118644
This is for eliminating images you never want to see again.
(I wonders how you get them back if you make a mistake - oh well)
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
6c4a2e No.12311101
Once you take the red pill, it's almost like you're living in a completely different world.
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
518715 No.12311102
>>12310994
snuff films and child pornography are against the law, if you searched out the evidence mentioned, you would have had to use research tools beyond this board to see that.
P.S. - don't try it, you seem too stupid to realize once on your computer you are now accessory to a crime.
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
a31a04 No.12311103
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
f5d86c No.12311104
I like this pic better than the usual
masked Asian chicks .
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
385563 No.12311105
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
56c68e No.12311106
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
17a2ff No.12311108
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
fd75bf No.12311109
So if I do travel it'll be with this story:
"I have a self published site and I am 'working' the 'poltical protest' so you have no authoritae to do anything more than show me your cheery eyes and wish me well in my travels or assist me should I need you too, sir or maddam or whatever you prefer to be called."
if you book in Md they might say '10 daze at the BaccchhhQue of the Buzss' to the detention quarantine facilitattatae unless you have an authorizzed by my pension funds test for the phake-en-gay virus.
that even if you get the test it means nothing except it enriches those who give it or provide it.
anyway, so ya, if you stay in PA or MD and even NJ you need to be worried about hassles. (wait, I didn't find out about NJ
only VA seems hassle free but they still have the brain-dead 'you must wear a mask inside' requirement.
if you are on business they give you a pass in MD and PA but not sure about NJ.
the point of the 'free commerce' clause is so that we don't have to deal with this.
as it is I have to buy a card to use the subway and give them money up front . . .
or to park and face the question 'mame, where is your test result'.
I have a quilting website and I'm doing business research on patriotic quilt designs so I'm on business travell and you can't harm me.
but they don't want to harm me.
all the quarantine and test requirements are uncivil hazing.
I run a fishing website and I'm doing reserach on trout at the Reflecting Pool because I heard it's going to be the national surfing tidal pool slash national trout pond when renovations are done and toxic waste sites removed from local buildings nearby and in the view of better buildings, needing to have expanded basements like they would do in the old world (just build it into a vault and build on top of it.
)
we could do a recreation of the Pallantine Hill circa 300 AD . . . complete with a hipodrome and a surfers pool . . .
and a 'Graftaneum': with monuments to various grafts, grifts, and shameful appropriation shinanagins . . .
is it a Griftnaeum of a Graftnaeum?
Naeum, niaum? you can call the whole thing off but the people still want fair elections.
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
a31a04 No.12311110
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
6c4a2e No.12311111
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
c960aa No.12311112
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
a31a04 No.12311113
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
c78e02 No.12311114
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
3bb08e No.12311115
>>12311101
wth no friends.
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
022f3c No.12311116
Rush not back on the air today. Hope he is still winning the battle.
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
ae69bb No.12311117
>>12311060
MAGA Patriots: General Flynn is a pile of shit. Ask him about the 500 thousand Christian people killed under his watch….. Fuck you general Flynn.
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
47cf17 No.12311118
>>12311097
If the entire frame of the WTC's was steel - then we should have seen it melt into a pile by the official story, not collapse into dust.
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
2234b7 No.12311119
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
4b1a9a No.12311120
>>12311074
WHO CARES ABOUT THE NORMIES ANYMORE??
They will either ride the wave or drowned.
Release it all!
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
17a2ff No.12311121
>>12311111
Check’d
Martial Law it is!
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
dcb9e0 No.12311122
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
b157a2 No.12311123
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
3bb08e No.12311124
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
ba7d7e No.12311125
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
ef5c37 No.12311126
Precipice
–Press Appease
—Press app ice…(!)
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
b068d6 No.12311127
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
a31a04 No.12311128
>>12311111
>11:11:11
>12311111
holeymoley anon, chkt!
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
f5d86c No.12311129
>>12311103
Killer looks like what's his name
from what's that movie.
Axe through the door, face peeking in,
what was it he said again?
"Heeeere's Johnny."
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
dcb9e0 No.12311130
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
8d25df No.12311131
Notables Are Not Endorsements
#15715
>>12310914 Bobby Piton insinuating a fake MSM hit piece coming out on him
>>12310905, >>12310924 John Cardillo is unhinged because of Lin Wood
>>12310973 It’s a Planned Panic-demic.`
>>12311007, >>12311010 Shadow strike.
>>12311080 Cheap hair lice drug may cut risk of COVID-19 death by 80 percent: study
>>12311089 How the fake news industry manufactures hoaxes
>>12311096 The 1973 Home Rule Act
>>12311098 Congress Approves Rules Regulating Jan. 6 Electoral Vote Count
>>12310921, >>12311021 pf
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
3bb08e No.12311132
anons, wtf do you park if you're headed to DC from NE?
No, anon does not want to meet you.
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
228a39 No.12311133
Raffensberger thinks by saying "That's not true" or "We got different numbers" without showing proof, will make this all go away.
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
0f175b No.12311134
>>12310903
this partly for pushing them into the satanist matriarchal societal model
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
e34828 No.12311135
>>12311101
And trying to tell enlighten others about all of it is the craziest mindfuck ever.
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
49fc32 No.12311136
>>12311081
They may try this old trick again. FF incoming, blame the NG. They will not succeed if they attempt
https://en.m.wikipedia.org/wiki/Kent_State_shootings
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
cb893e No.12311137
>>12311120
Normies comply. Just a matter of who’s in charge.
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
a29ff6 No.12311138
>>12311117
oh fuck you, faggot
He's a fucking General. A military man. People die. You are a fucking homo.
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
235da0 No.12311139
>>12311096
>>12310742
>>12310704
"I was looking for info on her ability to shut down travel in DC, and I came across an article that mentioned a little known ACT that allows POTUS to force her to hand over control of DC police. He has 48 hours after doing it to notify Congress."
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
47cf17 No.12311140
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
404b7b No.12311141
>>12311025
>1/20 is right around the corner
Q111: The complete picture would put 99% of Americans (the World) in a hospital.
Q142: The truth would put 99% of people in the hospital. It must be controlled.
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
a31a04 No.12311142
mike pence wife owned by chyna?
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
3bb08e No.12311143
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
5ca7df No.12311144
YouTube embed. Click thumbnail to play. Lin Wood Fireside Chat 4, Is Jeffrey Epstein Alive? Can Vice President Pence Be Trusted? + 100%
https://youtu.be/M27I3k-AV6c
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
666a80 No.12311145
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
f08cb6 No.12311146
>>12311133
Why not? It has worked for the Uni-Party traitors for decades!
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
a31a04 No.12311147
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
a29ff6 No.12311148
>>12311132
ever use a map?
gonna need more than your looks this time.
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
3bb08e No.12311149
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
5a98bb No.12311150
>>12311094
a 17yr old New Zealand kid is in jail for sharing the exact video I posted. He might be 18 now, since it's been a while, he may even be 19, but he's still in jail.
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
4a8786 No.12311151
New rules on removal of illegal online content could help in battle against child pornography
smoke screen for censorship
Ottawa drafting legislation to require removal from websites within 24 hours. A December 2019 mandate letter sent to Guilbeault by Prime Minister Justin Trudeau called for his department to create new regulations that would require social media platforms and adult websites operating in Canada to remove illegal content within 24 hours or face "significant penalties." The heritage minister says the coming regulations will apply to any company operating in Canada, regardless of where they are registered, where their head offices are located or where their servers exist.
https://www.cbc.ca/news/canada/manitoba/canada-illegal-online-content-child-porn-1.5847695
The letter
Create new regulations for social media platforms, starting with a requirement that all platforms remove illegal content, including hate speech, within 24 hours or face significant penalties. This should include other online harms such as radicalization, incitement to violence, exploitation of children, or creation or distribution of terrorist propaganda.
https://pm.gc.ca/en/mandate-letters/2019/12/13/minister-canadian-heritage-mandate-letter
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
518715 No.12311152
>>12311101
Those that know, don't sleep well if at all. The version of reality we are in is fluxing due to a time war effecting movie outcomes.
Start tracking your own list of mandela effects
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
d5b32d No.12311153
booby, you lost the board, faggot.
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
1ed846 No.12311154
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
3bb08e No.12311155
>>12311148
useless asshole filter.
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
a31a04 No.12311156
>>12311132
do you have a place to stay? park at hotel and i would call ahead to let them know you're almost there.
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
e2f0c4 No.12311157
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
beff4d No.12311158
>>12310872
>>12310381 pb
^^^THIS
Until LLCool Wood drops the sauce, all we got is dry-ass pasta.
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
ae69bb No.12311159
>>12311138
>>12311138
Shut your Chinese cocksuker asshole mouth@~
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
546cb4 No.12311160
>>12310863
Just so everyone is aware, Mayor BOWSER has no authority over DC NG. That power belongs to President Trump only due to DC's unique status. So this is just worthless piece of paper which has no authority to back it up.
"Trump has free rein in D.C. because of the city’s unique constitutional status. We only have “home rule,” granted by Congress, not sovereignty; we have no governor, so the D.C. National Guard answers to Trump, not to Mayor Muriel E. Bowser
https://www.washingtonpost.com/outlook/2020/06/05/dc-is-one-city-where-trump-can-indulge-his-police-military-fantasies/
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
d72ab3 No.12311161
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
4c76f7 No.12311162
>>12311133
Anon would be ashamed if POTUS was even a tiny fraction as upset with me as he was with Raffensturdburgler. And he was being gracious on that call. kek
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
3bb08e No.12311163
>>12311156
nah. commuting.
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
a29ff6 No.12311164
>>12311135
yeah? try being anon in Nov 2017.
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
666a80 No.12311165
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
f08cb6 No.12311166
>>12311117
never happened. But thank God he dusted shitloads of muslims!!
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
870559 No.12311168
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
a31a04 No.12311169
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
eaad9b No.12311170
>>12310872
Exaclty.
The bots are here to make him seem insane.
LOL. that will never work.
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
7af217 No.12311171
>>12311101
>Once you take the red pill, it's almost like you're living in a completely different world.
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
b157a2 No.12311172
>>12311152
I lose track of at least one whole day a week. whoosh
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
a5b386 No.12311173
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
e306e9 No.12311174
>>12311132
Find a train station as close as you wanna go, park there, ride the train into DC.
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
4d6d88 No.12311175
>>12311098
So it seems like a President Biden to me.
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
8bd541 No.12311176
>>12311072
They want everyone to believe this country is a democracy..which is why they use words like undemocratic.
You will never catch them uttering the word REPUBLIC.. which is what this country really is..
Not a memer..but distinguishing the differences here would be an important meme.
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
4dce7a No.12311177
>>12310863
She is on prescription psychotropics. In a big way.
Those drugs block you from the Holy Spirit.
People who take Trunalimunumaprzure(tm) should not be the position of making decisions for the well-being of others. The streets of DC are not like your home town.
Her signature almost even looks like she is trying to copy BHO's. kek
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
349a29 No.12311178
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
2234b7 No.12311179
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
47cf17 No.12311180
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
a29ff6 No.12311181
>>12311159
the little faggot is triggered! LMFAO
kek kek kek
so fucking FUNNY to see you sperg out
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
42e15f No.12311182
>>12311115
Dumbing yourself down to have relationships is truly painful. Told a long time close friend recently that I would slap the shit out of anyone who murmurs the word "covid" in my presence. He wasn't taking the hints otherwise.
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
e2f0c4 No.12311183
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
dcb9e0 No.12311184
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
000000 No.12311185
>>12311111
Checked
I guess its all settled then…
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
a31a04 No.12311186
>>12310872
the problem that normies have with it, is that it's exactly what all these "crazy conspiracy theorists" ie. anons, anyone questioning the narrative, as being correct. it fucks with their cognitive dissonance.
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
e34828 No.12311187
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
3bb08e No.12311188
>>12311174
ain't gonny mask anon
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
ea3c45 No.12311189
Father, as I walk this path that you have set before me, let me take time to thank Mother earth for allowing me to walk upon her green grasses, for brother sun who shines brightly upon me, for the 4 brothers of the winds who send the sweet scent of flowers to me, and for the gift of sister moon who shines to guide me through the night.
WA DO
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
8d25df No.12311190
Notables Are Not Endorsements
#15715
>>12310914 Bobby Piton insinuating a fake MSM hit piece coming out on him
>>12310905, >>12310924 John Cardillo is unhinged because of Lin Wood
>>12310973 It’s a Planned Panic-demic.`
>>12311007, >>12311010 Shadow strike.
>>12311080 Cheap hair lice drug may cut risk of COVID-19 death by 80 percent: study
>>12311089 How the fake news industry manufactures hoaxes
>>12311096, >>12311139 The 1973 Home Rule Act
>>12311098 Congress Approves Rules Regulating Jan. 6 Electoral Vote Count
>>12311160 Mayor BOWSER has no authority over DC NG. That power belongs to President Trump only due to DC's unique status.
>>12310921, >>12311021 pf
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
a29ff6 No.12311191
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
1ed846 No.12311192
https://twitter.com/Not_the_Bee/status/1345512562897661953
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
dcb9e0 No.12311193
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
fd75bf No.12311194
So years from now will they make a Cannonball run type movie about all the people who are road tripping to WAshington DC tomorrow night and how just make it in time to see . . .
well only some people know that, I sure don't.
If I can't get there I'll send my prayers and be vigilant during it and watch it live.
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
c6cd29 No.12311195
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
748849 No.12311196
>>12311060
>>12311083
I know it might be hard for many here to accept but not all military is /ourguys/
We've seen evidence of this over and over since the digital war began.
>Vindman
>NG Whistleblower, Adam Demarco
>Mattis
>McRaven
But muh Martial law. But muh military tribunals!
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
eaad9b No.12311197
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
dcb9e0 No.12311198
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
83a1be No.12311199
>>12311069
>https://twitter.com/TheBabylonBee/status/1346131807985692674
>Mandate And Womandate
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
546cb4 No.12311200
>>12310947
They don't have to respond to this at all because President Trump controls DC National Guard, not the Mayor. I hope Major General Walker knows the law too.
https://www.washingtonpost.com/outlook/2020/06/05/dc-is-one-city-where-trump-can-indulge-his-police-military-fantasies/
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
a29ff6 No.12311201
>>12311187
ok then. you must know how much EASIER it is now. People are catching on.
As Q said, it will happen FAST.
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
ef5c37 No.12311202
There were 18 attempted calls from the White House to GA secretary of state's office, sources say
https://edition.cnn.com/2021/01/04/politics/trump-brad-raffensperger-calls-georgia/index.html
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
c6cd29 No.12311203
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
193173 No.12311204
Guise I have a hunch:
MSM and all the talking heads
are missing the whole point of
POTUS 45 Trump
allowing himself to be recorded
telling GA
he only needs
11,780 votes
to be SPECIFIC.'
POTUS is alerting
to all who are paying attention
THEY ALREADY HAVE IT ALL
allowing GA fu*ks traitors
THEM
to be the ones on the phone being recorded
to be aired worldwide as KNOWINGLY lying.
Trump is all COMMS
as to what is up
and what is about to go down
A'ND WHAT THEY KNOW'
It is all a Q troll all day long and they bite every time.
11,780 adds up to 17 which is Q COMMS'
BUT EVEN MORE IT IS A CALL TO DIG ???
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
c55e5a No.12311205
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
2234b7 No.12311206
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
503d27 No.12311207
>>12310863
>Mayor Bowser is requesting support by the NG for Jan. 6th.
Anon sees it just the opposite. It's to neuter them. Note: No DCNC personnel shall be armed, at no time, will DCNC personnel or assets be engaged in domestic surveillance searches, or seizures of US persons.
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
aee2a0 No.12311209
>>12311045
Yes and we discussed whether it was we >>12311074
Again lazy as you appear to be THERE ARE FUCKING PROOFS ALL IVER THE PLACE YOU ARE HERE
FIND THEM OR GO BACK TO NORMIEVILLE
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
4dce7a No.12311210
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
193173 No.12311211
>>12311204
LOOK and THINK guise : 'find 11.780 votes' IS A THING for us to dig on
'
now PAY ATTENATION AS we ARE TO SEE THIS
11780 IS comms
Trump is telling them and us HE KNOWS something regarding 11780
Go to Duckduckgo safe search off
Simply type in 11780 Q
'''It AUTOMATICALLY takes you to the ANSWER tab, not to the tab for All or Images or Videos or News or Maps, it just goes to the ANSWER tab. I did not ask it to or direct it to the ANSWER TAB
When there look and THINK:
https://duckduckgo.com/?q=11%2C780+Q&atb=v225-1&ia=answer
It is pointing us to a lot of topics
A DIGG SHOULD ENSUE all things 11780 Q
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
a29ff6 No.12311212
>>12311196
please try to use your brain. Do you have one?
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
56c68e No.12311213
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
870559 No.12311214
>>12311117
Sloppy job Mossad
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
ef5c37 No.12311215
Resurfaced Video Of Dems Objecting to Electoral College Votes is BRUTAL
https://rumble.com/vcfb31-resurfaced-video-of-dems-objecting-to-electoral-college-votes-is-brutal.html
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
349a29 No.12311216
@michellemalkin
"FUCK PAUL RYAN."
https://twitter.com/michellemalkin/status/1345848117900398593
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
52ecf6 No.12311217
Hoping POTUS uses those rally big screens for some DECLAS. It's a powerful tool. Always thought it would be good to put some screens and loudspeakers in front of protesters to show them some facts about the criminals.
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
a31a04 No.12311218
>>12311177
>Her signature almost even looks like she is trying to copy BHO's. kek
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
18728d No.12311219
>>12310994
Then clearly you haven’t dug far enough. Best gore dot com has normal murder shiz. If you seek the crazy shit you gotta bust into dark web territory. Hell, even on Usenet and Torrents there’s plenty of illegal F’ed up shit. I’ve unintentionally seen plenty to last a lifetime.
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
c6cd29 No.12311220
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
193173 No.12311221
>>12311204
the items that populate are curious indeed:
MASS
11780
Metric "Q"uintal = 1178000000
Trump, GA, WAPO, FARK.com (11070772) Dis Trukp break state and federal, adresses in SAINT JAMES, NY, Who lives at,
Covid-19 product Hillyard- HIL0016700 Q.T. information for a hard surface disinfectant that is effective,
MOVIE THEATER TIMES,
then another link for the Hillyard Covid-19 cleaner,
Allstate Insurance Ryan Dittmar, Saint James, NY,
radioation dose from X-ray scatter,
ADDRESSES in SAINT JAMES, NY
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
d1be3e No.12311222
>>12311118
What’s your point? That the towers didn’t have 47 steel box columns running through the core of the structure? Or something else?
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
a1b27b No.12311223
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
bc083b No.12311224
>>12311115
Probably ostracized myself from one of the hockey teams I play on last night at a team party… fuck em. If we are right they will have to come around sooner or later
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
e306e9 No.12311225
>>12311188
wear a nice western bandanna. Pull it up, let it fall, no one much says anything.
I don't wear em myself, or any mask, just so I can yell at someone if they say something to me, but that's me. I plainly don't give a fuck for any authority save that of our Creator.
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
81359e No.12311226
Here the deal my ATS friend
Ya my 3 day ban turn into a life ban
Your next
Please add any new one here
New _Ghost Drop on ATS
http://files.abovetopsecret.com/files/img/kl5eb8a558.png
http://files.abovetopsecret.com/files/img/bu5eb8a579.png
http://files.abovetopsecret.com/files/img/qa5eb8a5a0.PNG
http://files.abovetopsecret.com/files/img/lf5eb8a6de.PNG
http://files.abovetopsecret.com/files/img/mn5eb8a6fd.PNG
http://files.abovetopsecret.com/files/img/yf5eb8a7f7.PNG
http://files.abovetopsecret.com/files/img/zh5f68b760.png
http://files.abovetopsecret.com/files/img/or5fa0bb4b.PNG
New one Dec 12/20
http://files.abovetopsecret.com/files/img/wm5fd55bfa.PNG
New One Dec 28/2020
http://files.abovetopsecret.com/files/img/ca5feada9c.PNG
https://endchan.net/qanonresearch/res/48336.html#48510
https://endchan.net/qanonresearch/res/48336.html#49389
https://endchan.net/qanonresearch/res/49106.html#49628
https://endchan.net/qanonresearch/res/49106.html#49651
https://youtube.com/watch?v=iMhDySGyI9E
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
ec5417 No.12311227
https://twitter.com/KyleHooten2/status/1346142068670922753?s=19
Looks like protestors may have replaced an American flag with the Somali flag in south Minneapolis
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
9c9792 No.12311228
>>12311022
Ideo mittet illis Deus operationem erroris ut credant mendacio,
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
9a3f48 No.12311229
>>12310704 (pb)
re NG and DCMPD on 1/6
Find And Stay Near Veterans (milanons) AND Leave in Groups
Took my teen kids to the Inauguration in 2016. The NG AND the DCMPD completely STOOD DOWN as pantifa disrupted ALL the long lines to enter the parade route and flood the Mall. There were easily 500 - 750K of us who were prevented from entering through the few security gates. All of us MAGA families were pissed off and complaining to the PD and NG (ALL were black, BTW) and they thought it was the funniest thing ever as they openly allowed pantifa to stand in large groups blocking each of the entrances. Once we all realized what was going down after POTUS speech ended we all headed to the Metros to escape the gangs of pantifa who had torched DC the previous nights. My advice would be to find and stick with groups of Veterans/anons and leave in groups at the end of the day. If you notice lone families or small groups, take them under your wing as you are getting near the end of the day. Try to help any stragglers you may run into as the walking dead will begin to show themselves as the sun gets low.
Remember
WWG1WGA!!!
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
0cdb7d No.12311230
Odd place for a quake don't you think frens.
https://earthquake.usgs.gov/earthquakes/map/?currentFeatureId=us6000d5g7&extent=21.9838,-130.16602&extent=51.78144,-59.85352
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
b157a2 No.12311231
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
3bb08e No.12311232
>>12311216
crush intensifies
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
193173 No.12311233
>>12311204
The very first and all other items that come up are
Q.11780: In the public sector, as opposed to the privat
Q.11780: In the public sector, as opposed to the privat
Search domain www.briefmenow.org/isc2/in-the-public-sector-as-opposed-to-the-private-sector-due-care-is-usually-determined-by-2/www.briefmenow.org/isc2/in-the-public-sector-as-opposed-to-the-private-sector-due-care-is-usually-determined-by-2/
ISC question 11780: In the public sector, as opposed to the private sector, due care is usually determined byA. Minimum standard requirements.B. Legislative
GA, Trump, Covid-19, addresses in Saint James, NY, MOVIE THEATER TIMES, radiation scatter dose info, Allstate Insurance Ryan Dittmar, Saint James, NY,
and adressess????
FOR SAINT JAMES, NY
7 Fox Point Dr.
280 7th Ave
Northern Blvd
11 Pheasant Run
7 Carmen Ln
3 Hawks Nest
139 Woodlawn
576 LongBeach Rd
41 pLANE tREE lN
A link for Broadband Internet in Saint James 11780 zip code just is in the middle???
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
e34828 No.12311234
>>12311201
For certain parts of this, yes.
There is still a lot to go through though and some of it is still hard to believe for most, even here.
Rip the veil off, I'm all for it.
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
2234b7 No.12311235
>>12311220
was a nice prayer though
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
193173 No.12311236
>>12311204
An address IN GEORGIA also come up???
11780 Ashwick Pl, Alphretta GA that highlights being near SCHOOLS in Fulton county.
11780 Ashwick Pl, Alpharetta, GA 30005 | 25 Photos | MLS …
Search domain www.movoto.com/alpharetta-ga/11780-ashwick-pl-alpharetta-ga-30005/pid_q0vdn69lbh/for-sale/https://www.movoto.com/alpharetta-ga/11780-ashwick-pl-alpharetta-ga-30005/pid_q0vdn69lbh/for-sale/
11780 Ashwick Pl Alpharetta, GA 30005 is located in the Fulton County School District and the nearest school is Abbotts Hill Elementary School. an ideal family neighborhood with Chattahoochee High School highly rated assigned schools. Discover more about the Alpharetta.
THEN YOU GET A LINK TO A COVID -19 HARD CLEANER
Hillyard - HIL0016700 Q.T. with a registered trademark symbol which reads:'''
Hillyard - HIL0016700 Q.T.®
Search domain b2b.hillyard.com/productdetail/index/grid/wwsa/C~11865,PL~11780,PD~HIL0016700https://b2b.hillyard.com/productdetail/index/grid/wwsa/C~11865,PL~11780,PD~HIL0016700
HIL0016700 Q.T.® Q.T. (EPA Reg # 1839-166-1658 ) has demonstrated effectiveness against viruses similar to 2019 novel coronavirus (SARS- CoV-2) on hard, non-porous surfaces. Therefore, this product can be used against SARS-CoV-2, the novel coronavirus that causes the disease COVID- 19, when used in accordance with the directions for use against Rotavirus on hard, non-porous surfaces. <br …
THEN you get MOVIE TIMES AND MOVIE THEATERS IN 11780-LOCAL SHOWTIMES
theaters near you
'THEN again :
Hillyard - HIL0082400 Q.T.® Plus
Search domain b2b.hillyard.com/productdetail/index/grid/wwsa/C~11865,PL~11780,PD~HIL0082400https://b2b.hillyard.com/productdetail/index/grid/wwsa/C~11865,PL~11780,PD~HIL0082400
Q.T. Plus is designed for use on walls,countertops,fixtures,restroom and shower rooms,and other hard surfaces where disinfectint is a must. On 7/29/20, The EPA published updated label claims on List N for QT Plus as effective against SARS-CoV-2, the virus that causes COVID-19 with a 3- minute contact time.
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
7b1d05 No.12311237
>>12311150
The ever-growing DS resort of tranny Jacinda.
The gun grab sealed it.
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
c6cd29 No.12311238
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
b871f9 No.12311239
>>12310951
>>12310863
Yes, that seemed significant to me, too. By requesting, is he trying to dictate the terms of their engagement? I think I might actually prefer that they are armed and ready to defend citizens.
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
748849 No.12311240
>>12311212
Tell me why I'm wrong or just continue to not provide evidence for why I'm wrong.
Would seriously appreciate to be wrong.
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
f5d86c No.12311241
>>12311147
Yup.
That's the one.
Still haven't watched that movie.
With the iconic snippets popping-up
repeatedly over the years, it seems like
I already had.
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
ff34b8 No.12311242
MAGA Patriots: General Flynn is a pile of shit. Ask him about the 500 thousand Christian people killed under his watch….. Fuck you general Flynn….
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
a29ff6 No.12311243
>>12311101
>Once you take the red pill, it's almost like you're living in a completely different world.
not almost. It is.
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
81359e No.12311244
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
4dce7a No.12311245
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
ba7d7e No.12311246
>>12311176
democracy = direct vote as individual
republic = representative vote, with the STATES as the voters.
This is why the leftists do not like the EC.
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
ad1cad No.12311247
>>12311204
He probably said something with enough plausible deniability but also enough controversy that they would release the call if they were taping it.
Trump is a genius
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
47cf17 No.12311248
>>12311222
20 years living the lie.
This is the year we take the Truth out for all to see.
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
193173 No.12311249
>>12311204
all should be looked at???
so much more that seems odd
all with the simple 11, 780 Q as the search:
SOME MAY BE NOTHING AT ALL OTHERS MAY BE SOMETHING????
https://clustrmaps.com/a/34q10d/
11780 Borman Dr, St. Louis, MO Public Records
Search domain clustrmaps.com/a/34q10d/https://clustrmaps.com/a/34q10d/
This address may be also written as 11780 Borman Drv, St. Louis, MO 63146.
We know about 48 companies registered at this address. These are some of the names: Nba Disciples Housing of Boise, Idaho, Inc and The Redemption Group Network. Nba Disciples Housing of Boise, Idaho, Inc is connected to this address through UCC records. Children's Hope International Foundation (licence Corporation Public Charity) and Children's Hope International/china's Children (licence Religious Organizations) are license holders registered here.. This address is #836 on the list of state addresses by the number of businesses registered there. WHOIS records associate this address with five domain names. Three registrant names found. This address may be also written as 11780 Borman Drv, St. Louis, MO 63146. 38.693957,-90.433225 are the latitude and longitude of the address location. Monthly rental prices for a two-bedroom unit in the zip code 63146 is around $1,110
qBittorrent
Wrong number of torrents with tracker problems displayed …
Search domain github.com/qbittorrent/qBittorrent/issues/11780https://github.com/qbittorrent/qBittorrent/issues/11780
Please provide the following information qBittorrent version and Operating System v4.2.1, windows 8.1 If on linux, libtorrent-rasterbar and Qt version (type here …
Blue Geri Velvet Queen Bed | GeriNavy-Q
Search domain www.meridianfurnitureusa.com/sitefiles/product-1437-11780/geri-bed-blue.htmlhttps://www.meridianfurnitureusa.com/sitefiles/product-1437-11780/geri-bed-blue.html
queen size Geri Velvet Bed in blue features soft midnight navy velvet, gold & chrome legs included, piping on headboard and footboard, contemp…
https://www.meridianfurnitureusa.com/sitefiles/product-1437-11780/geri-bed-blue.html
Weird Chinese game shit thta talks about SPELLS: https://www.op.gg/champion/cassiopeia/statistics/mid
s11 Middle Cassiopeia build guides, counters, guide, pro …
Search domain www.op.gg/champion/cassiopeia/statistics/midhttps://www.op.gg/champion/cassiopeia/statistics/mid
Cassiopeia build guides - op.gg provides builds, counters, guides, masteries, runes, skill orders, combos, pro builds and statistics by top, jungle, mid, adc, support …
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
299b63 No.12311250
>>12311229
notable
Anon advice DC Travel
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
af7243 No.12311251
For those interested, Sol Wisenberg has finally come out of the closet as the swamp rat he is. He's a calm, measured, and logical guy so his panic is hard to discern, but it's there nonetheless.
https://twitter.com/WisenbergSol
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
a29ff6 No.12311252
>>12311242
you fucking cunt KILL YOURSELF
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
50fd09 No.12311253
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
8bd541 No.12311254
>>12311204
Anon, remember when there was an overnight watch over the vote machines in GA.. CM reported that they were picked up in trucks and taken away?? Hmm wonder who has them?.. who really has them?
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
6ba4a6 No.12311255
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
c6cd29 No.12311256
>>12311235
not a chance, I believe th bible is a
cook book, it's not what you think
it says,
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
2c08a3 No.12311258
>>12310856 PB
Hmm…that makes you a cancer to humanity! Perhaps you could practice another way of existence!
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
0ddfc2 No.12311259
>>12311216
If I were so fortunate as to cuff Ryan, I might accidentally slam him into a door frame on the way out.
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
07d1f1 No.12311260
>>12311242
I'll check out your suggested URL
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
193173 No.12311261
>>12311204
NO REFERENCE TO 11,780 Q, the search info, AT ALL
Best Korean BBQ Near Me - January 2021: Find Nearby … - Yelp
Search domain www.yelp.com/nearme/korean-bbqhttps://www.yelp.com/nearme/korean-bbq
Find the best Korean BBQ near you on Yelp - see all Korean BBQ open now and reserve an open table. Explore other popular cuisines and restaurants near you from over 7 million businesses with over 142 million reviews and opinions from Yelpers.
A 8,060.00 Chandlier link: https://www.build.com/allegri-11780/s890176
1 in stock CHROME
from the Quantum Quadro Collection
Allegri 11780 - Build.com
Search domain www.build.com/allegri-11780/s890176https://www.build.com/allegri-11780/s890176
Save up to 50% on the Allegri 11780 from Build.com. Low Prices + Fast & Free Shipping on Most Orders. Find reviews, expert advice, manuals & specs for the Allegri 11780.
MAY BE A WAY TO COMMUNICATE about software?
a link to ask and answer developers about BUGs in tech code and software quality
a stack eexchange network
with all sorts of links like:
Security implications of granting non-root access to privileged ports (<1024)
https://sqa.stackexchange.com/questions/11780/what-should-qa-ask-developers-they-are-interviewing
Software Tester Job Interview: Case studies on Test Design
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
a56189 No.12311262
>>12311005
It’s so tiring to always be in damage control mode for my lib acquaintances.
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
91b08e No.12311263
>>12311242
You scared, AJ?
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
aeb1f0 No.12311264
>>12310924
Nothing to see here.
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
4a8786 No.12311265
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
9cb40c No.12311266
>>12311232
Be careful who you follow, anon. Michelle Malkin:
https://twitter.com/michellemalkin/status/1245853793780002824?lang=en
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
a29ff6 No.12311267
>>12311240
The Remedial Reading Room is down the hall.
I don't teach dummays.
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
193173 No.12311268
>>12311204
and this
may be nothing
The Knox School - Our Home Beside the Shore
Search domain www.knoxschool.orghttps://www.knoxschool.org
Join us on Saturday, November 14th at 7:30 PM for The Knox School's Virtual Production of Qui Nguyen's She Kills Monsters She Kills Monsters tells the story of Agnes Evans…
Field Office Locator | SSA
Search domain www.ssa.gov/locator/www.ssa.gov/locator/
Looking for a local office? Use one of our online services and save yourself a trip!
FLORIDA COMES UP???
11780 Seaview Dr, Vero Beach, FL 32963 | 23 Photos | MLS …
Search domain www.movoto.com/home/11780-seaview-dr-vero-beach-fl-32963-pid_1s0q67q8ahhttps://www.movoto.com/home/11780-seaview-dr-vero-beach-fl-32963-pid_1s0q67q8ah
11780 Seaview Dr Vero Beach, FL 32963 is located in the Indian River and the nearest school is Sebastian River High School. an ideal family neighborhood with Sebastian River High School highly rated assigned schools. Discover more about the Vero Beach. As of today, there are 337 properties listed for sale in ZIP code 32963 and 1,013 properties
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
c6cd29 No.12311269
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
f5d86c No.12311270
>>12311154
I tried to watch this movie.
Unsuccessful.
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
81359e No.12311271
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
ea3c45 No.12311272
>>12311206
>>12311220
It's a Cherokee new year prayer anon
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
4c76f7 No.12311273
>>12311239
>is he trying to dictate the terms of their engagement?
She. DC mayor made request.
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
a1b27b No.12311274
>>12311216
>>12311266
She can be wrong about Jared Kushner and right about Paul Ryan.
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
ef5c37 No.12311275
sometimes it passes by and camouflages itself like a bot….
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
b02bb8 No.12311276
>>12311230
and at 5km depth too
Tyndall AFB
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
193173 No.12311277
>>12311204
CHINESE SHIT:
We believe in Star/Voice supremacy
salem9, Dec 17, 2020
Discussion in 'K-POP' started by salem9, Dec 17, 2020.
LOONA's comeback would've been waaay bigger if …
Search domain www.allkpop.com/forum/threads/loonas-comeback-wouldve-been-waaay-bigger-if.523092/https://www.allkpop.com/forum/threads/loonas-comeback-wouldve-been-waaay-bigger-if.523092/
JYPE H.Q. nuff-nuffs-nice said: … 11,780. They would have flopped no matter what. At least they sold some albums. Meh #9 atropos, Dec 17, 2020. hamsin5 likes this. FatesSoneCardi Public Figure.
https://www.allkpop.com/forum/threads/loonas-comeback-wouldve-been-waaay-bigger-if.523092/
DO YOU SEE 11,780 Q ANYWHERE IN THIS LINK THAT COMES UP FOR RAM STORAGE?
WHY DOES THIS PHONE COME UP??????
MI Poco M2 (Pitch Black, 6GB RAM, 64GB Storage): Amazon.in …
Search domain www.amazon.in/MI-Poco-Pitch-Black-Storage/dp/B08JCSS94Shttps://www.amazon.in/MI-Poco-Pitch-Black-Storage/dp/B08JCSS94S
16.59 cm (6.53 inch) Full HD+ Display 13MP + 8MP + 5MP + 2MP | 8MP Front Camera 5000 mAh Lithium Polymer Battery MediaTek Helio G80 Processor POCO M2 Has 6.53 inch display with resolution of 1080x2340 it has 2GHz+ 1.8GHz Dual plus Hexa Core Media Tek Helio G80 Processor, 5000 mAh LI-Polymer Battery, 18W of Quick Charge Android V10(Q) Operating System Dual GSM+GSM Sim , nano+nano , 4G VoLTE …
https://www.amazon.in/MI-Poco-Pitch-Black-Storage/dp/B08JCSS94S
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
c6cd29 No.12311278
>>12311270
I've lived that movie,
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
91b08e No.12311279
>>12311245
Kamala called me a racist but cmon man, she aint black
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
4a8786 No.12311280
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
3a651c No.12311281
>>12310872
Allegory of the Cave Analogy
If my culture were trapped watching shadow puppets, and I wanted to predict our ability to escape the cave, one metric of key concern is percentage of population satisfied with the shadows vs those straining to see elsewhere.
In this way, comparing the public’s social media interaction with Lin Wood vs MSM is interesting.
Images related.
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
a29ff6 No.12311282
>>12311258
think he was being facetious,
satirizing what (((they))) do
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
193173 No.12311283
>>12311204
AND THIS
ContentDialog ignoring CanExecute
"This seems like a bug, but seeing it hasn't been changed since '14, I'm wondering if this design is intentional."
ContentDialog ignoring CanExecute - Microsoft Q&A
Search domain docs.microsoft.com/answers/questions/11780/contentdialog-ignoring-canexecute.htmlhttps://docs.microsoft.com/answers/questions/11780/contentdialog-ignoring-canexecute.html
Welcome to our Microsoft Q&A platform! From the style of ContentDialog, there is a Button named PrimaryButton which represents PrimaryButton. It has bound Content, IsEnabled property, etc, but doesn't bind Command property, it should be why CanExecute has no effect. So you can use TemplateBinding to bind PrimaryButtonCommand with Command.
https://docs.microsoft.com/en-us/answers/questions/11780/contentdialog-ignoring-canexecute.html
DO YOU SEE ANYTHING THAT SAYS 11,780 Q ? BUT THIS COMES UP
Home - St. James Rehabilitation and Healthcare Center
Search domain stjamesrehab.comstjamesrehab.com
St. James Rehabilitation and Healthcare Center provides unprecedented levels of genuine care and customer service for our communities' Rehabilitation and Nursing needs, in a soothing, tranquil and state-of-the-art environment.
http://stjamesrehab.com/
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
1894cf No.12311284
>>12311132
https://www.spotangels.com/washington-dc-parking
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
3bb08e No.12311285
>>12311274
or right about both
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
8d25df No.12311286
Notables Are Not Endorsements
#15715
>>12310914 Bobby Piton insinuating a fake MSM hit piece coming out on him
>>12310905, >>12310924 John Cardillo is unhinged because of Lin Wood
>>12310973 It’s a Planned Panic-demic.`
>>12311007, >>12311010 Shadow strike.
>>12311080 Cheap hair lice drug may cut risk of COVID-19 death by 80 percent: study
>>12311089 How the fake news industry manufactures hoaxes
>>12311096, >>12311139 The 1973 Home Rule Act
>>12311098 Congress Approves Rules Regulating Jan. 6 Electoral Vote Count
>>12311160 Mayor BOWSER has no authority over DC NG. That power belongs to President Trump only due to DC's unique status.
>>12311215 Video Of Dems Objecting to Electoral College Votes
>>12311229 Anon advice DC Travel
>>12310921, >>12311021 pf
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
3bb08e No.12311287
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
a1b27b No.12311288
>>12311285
Or not right about one and right about the other.
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
9cb40c No.12311289
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
748849 No.12311290
>>12311267
Those who can't present evidence result to insults
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
c6cd29 No.12311291
>>12311272
interesting,
you & others, ppl poppin they heads out th sand,
nice to see that ppl know what they lookin at,
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
2234b7 No.12311292
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
193173 No.12311293
>>12311204
again
some may be nothing
but a lot is in between the
different links that populate
OR THIS
Audi of Smithtown | Audi Dealership in Smithtown, NY
Search domain www.audiofsmithtown.comhttps://www.audiofsmithtown.com
Audi of Smithtown in St. James, NY treats the needs of each individual customer with paramount concern. We know that you have high expectations, and as a car dealer we enjoy the challenge of meeting and exceeding those standards each and every time.
https://www.audiofsmithtown.com/
Operators Manuals | Lincoln Electric
11780
IM10096
POWER MIG 256 - 11780
Search domain www.lincolnelectric.com/en-us/support/Pages/operator-manuals.aspx?type=code&q=11780https://www.lincolnelectric.com/en-us/support/Pages/operator-manuals.aspx?type=code&q=11780
Product Names and Code Numbers can be found on the name plate of welders and wirefeeders. In order to ensure you have the correct Operator's Manual for your machine you must use a Code Number Search.
https://www.lincolnelectric.com/en-us/support/Pages/operator-manuals.aspx?type=code&q=11780
Laqjuana Houser in Redford, MI - Bizapedia Profile
Search domain www.bizapedia.com/people/michigan/redford/laqjuana-houser.htmlhttps://www.bizapedia.com/people/michigan/redford/laqjuana-houser.html
Laqjuana Houser is listed as an Agent with Q's Raw Smoothies LLC in Michigan. The address on file for this person is 11780 Columbia, Redford, MI 48239 in Wayne County. The company is a Michigan Domestic Limited-Liability Company, which was filed on March 12, 2018.
Words That Rhyme With 11780 - Rhymes.net
Search domain www.rhymes.net/rhyme/11780https://www.rhymes.net/rhyme/11780
This page is about the various possible words that rhymes or sounds like 11780. Use it for writing poetry, composing lyrics for your song or coming up with rap verses. 11780 is the US ZIP code of Nesconset, Head of the Harbor, St. James, Smithtown, Stony Brook, Nissequogue - New York …
11780 Wellsley Way, Alpharetta, GA 30005 - Townhouse for …
Search domain www.apartments.com/11780-wellsley-way-alpharetta-ga/q9v0mxy/https://www.apartments.com/11780-wellsley-way-alpharetta-ga/q9v0mxy/
About 11780 Wellsley Way Alpharetta, GA 30005. Fabulous 3 sided brick townhome with 3 bedrooms and 3.5 baths, plus a two car attached garage. Chef's kitchen boasts granite countertops & wood floors all overlooking the dining area & fireside great room.
CHINESE YOUTUBE VIDEO GAME RECORDING
Pikmin 3 Deluxe: Side Stories - Day 1: Flower Garden 11780 …
Search domain www.youtube.com/watch?v=cMqDRH4q5-8https://www.youtube.com/watch?v=cMqDRH4q5-8
So the side stories do not seperate single and co op on the leader board. Oh well, still fun to run but about 24 seconds from WR on the board.
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
81359e No.12311294
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
4470a2 No.12311295
Inbox: Georgia secretary of state's office to hold press conference Monday at 3 P.M.
https://twitter.com/joshdcaplan/status/1346144530874175489
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
f08cb6 No.12311296
>>12311239
Who is 'he'? The mayor of DC is the nigger lesbian wife of Donna Brazile.
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
07d1f1 No.12311297
>>12311266
this chick looks like her head got squished at birth
I have nothing against Kushner, so she is wrong there.
I hear a lot of hate, waiting for the proof. Muhjoo is not enough - never is.
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
dcb9e0 No.12311298
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
b7db35 No.12311299
>>12311126
>Precipice
>–Press Appease
>—Press app ice…(!)
Yeah, that's how this works… homonyms
Fuck's sake
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
a29ff6 No.12311300
>>12311290
those who are lazy ask others for evidence. Do your own fucking research. Convince yourself. I don't give a fuck what you believe.
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
9cb40c No.12311301
>>12311274
Precisely. As a matter of fact, that's exactly how the game is played.
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
3bb08e No.12311302
>>12311288
not sure that's an option, anon
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
7b1d05 No.12311303
>>12311248
I hope you're right.
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
5a98bb No.12311304
Commas before Conjunctions, Anons?
What's the consensus?
I might know already, but I'd like (you)'re opinions.
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
a1b27b No.12311305
>>12311295
"POTUS was mean to us fraudsters, he told us to manufacture votes"
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
8d2e41 No.12311306
>>12311159
huomosplaination of how xi ping hurt the mis gendered demonrat or repugnant bad cop good cop neo con - all traitors
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
02c7ef No.12311307
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
91b08e No.12311308
>>12311281
I have hope
Though a lot of people are watching the shadows, It's hard to think of any period in history where more people have escaped that cave worldwide.
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
fd75bf No.12311309
>>12311296
are there restrooms at DC city hall open to the public?
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
f5d86c No.12311310
>>12311248
Can't wait for this revelation.
Bring it!
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
ea3c45 No.12311311
>>12311272
Been researching since oct 2017
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
9c9792 No.12311312
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
193173 No.12311313
>>12311204
11,780 Q as the search :
https://www.questdiagnostics.com/home/physicians/testing-services/condition/genetics/
Genetic testing : Genetics - Quest Diagnostics
Search domain www.questdiagnostics.com/home/physicians/testing-services/condition/genetics/www.questdiagnostics.com/home/physicians/testing-services/condition/genetics/
QNatal® Advanced, an automated cfDNA noninvasive prenatal screening assay, demonstrates excellent performance characteristics, high positive predictive values, and very low "no-call" rates.Its validated technology delivers accurate results with clear positive or negative reporting for chromosomal abnormalities.
A Review of United States Air Force and Department of Defense Aerospace Propulsion Needs
https://www.nap.edu/read/11780/chapter/10
MyNAP members save 10% online.
Login or Register to save!
Rocket and air-breathing propulsion systems are the foundation on which planning for future aerospace systems rests. A Review of United States Air Force and Department of Defense Aerospace Propulsion Needs assesses the existing technical base in these areas and examines the future Air Force capabilities the base will be expected to support. This report also defines gaps and recommends where future warfighter capabilities not yet fully defined could be met by current science and technology development plans.
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
b871f9 No.12311314
>>12311273
thx.
I hate wasting bread, but it seems rude not to reply.
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
327bc8 No.12311315
Hey Q, could we get a little of pic-related, for old times sake?
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
1894cf No.12311316
>>12311132
https://spothero.com/washington-dc-parking
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
50fd09 No.12311317
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
b157a2 No.12311318
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
a1b27b No.12311319
>>12311301
What game?
>>12311302
Pretty sure it is. After all, Stalin once said 2+2=4 yet he was also wrong about stuff.
It's possible as an option.
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
2234b7 No.12311320
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
3bb08e No.12311321
>>12311309
can always go "san francisco" style
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
c94518 No.12311322
>>12311297
>Muhjoo is not enough - never is.
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
dcb9e0 No.12311323
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
193173 No.12311324
11,780 Q as the search
ZIP Codes(0.00 / 0 votes)Rate this definition:
11780
11780 is the US ZIP code of Nesconset, Head of the Harbor, St. James, Smithtown, Stony Brook, Nissequogue - New York
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
c6cd29 No.12311325
>>12311308
big time,
using all those in th past to give us hindsight,
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
9a3f48 No.12311326
>>12311225
Gonna be sunny and a high of 45 degrees. Patriotic "neck gaiters" or any type would be ideal as they'd keep you warm and you can just pull them up as "masks" if needed.
https://forecast.weather.gov/MapClick.php?lat=38.89&lon=-77.02#.X_MhGGjYrrc
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
a29ff6 No.12311327
>>12311309
>are there restrooms at DC city hall open to the public?
only for democrats (i.e., deviants, and antifa)
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
aee2a0 No.12311328
>>12311216
HER COUSIN WAS KIDNAPPED AND NEVER FOUND. SHE KNOWS that was a signal to her so not say anything. Malkin KNOWS about the trafficking. I am sure that was why they kidnapped her cousin
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
1e91c9 No.12311329
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
8d2e41 No.12311330
>>12311296
PISS ON THE BOW WOW BOWSER AND HER KHUNT BUFFALO COW BRAZILLE
AND PISS AND SHIT ON THE COPS PROTECTING THE TRAITORS
THAR FAR WORSE THAN THE TRAITORS
crying - 'oh give us respect, don't shoot us in the head…, - as they stand down for p00 p00 and let blm and antifa butt uck em in the arse
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
193173 No.12311331
>>12311324
11.780 Q as the search:
What does 11780 mean?
Definitions for 11780
11780
Here are all the possible meanings and translations of the word 11780.
Numerology
Chaldean Numerology
The numerical value of 11780 in Chaldean Numerology is: 0
Pythagorean Numerology
The numerical value of 11780 in Pythagorean Numerology is: 0
Images & Illustrations of 11780
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
a31a04 No.12311332
easiest classes to take when starting back in college after being gone for a while?
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
9cb40c No.12311333
>>12311319
>What game?
Information warfare, anon.
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
332f1b No.12311334
>>12311321
>can always go "san francisco" style
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
0cdb7d No.12311335
>>12311230
Tyndal is a city in south dakota
tyndal afb is in florida?
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
c6cd29 No.12311336
>>12311317
I take that as sarcasm,
you one my friends,
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
8bd541 No.12311337
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
3bb08e No.12311338
>>12311319
5:5 anon misread previous
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
f56d94 No.12311339
>>12311315
kek - That one's near the top of the Best of Gifs Non-Titty division, Anon.
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
a1b27b No.12311340
>>12311333
Be more specific anon.
"Information warfare" is a given.
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
07d1f1 No.12311341
>>12311281
to escape a cave, you need light
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
f9d326 No.12311342
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
b291cb No.12311343
Cuomo with a Pedo bracelet on?
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
dcb9e0 No.12311344
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
4e68dd No.12311345
Rigging elections, a family business.
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
a1b27b No.12311346
>>12311338
No worries, I do that all the time.
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
631631 No.12311347
>>12311242
How many Christian people did you save under his watch, Anon?
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
841da3 No.12311348
My 14 year old and his friend just told me there is a school sponsored satanic club at school
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
17a2ff No.12311349
Pelosi had this creature with Covid travel to D.C to vote for her
https://twitter.com/breitbartnews/status/1346145805506392075?s=21
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
bbd3b3 No.12311350
Anon's… trying my best not to be a concernfag, but something has GOT to come out quick and with a huge boom. I've been around for over 2 years, red pilled I couldn't count how many over the years. I am holding strong in faith, but I'm seeing daily A LOT of people just jumping ship and saying "OH WELL, yeah he stole it, but what can we do about it." and just simply don't care. People are starting to to accept that Biden actually won, and it's disheartening. I'm in a HEAVILY red state and area as well. Just doesn't make sense.
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
327bc8 No.12311351
>>12311339
Thx, had to throw that one together myself by hand
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
b157a2 No.12311352
>>12311332
start with Logic and maybe you'll get the last conservative instructor
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
393213 No.12311353
>>12311242
General as he was, I don't trust him.
But I'm gong to need a sauce on this
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
b291cb No.12311354
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
193173 No.12311355
>>12311204
11,780 Q as the search
ZIP Codes(0.00 / 0 votes)Rate this definition:
11780
11780 is the US ZIP code of Nesconset,
Head of the Harbor,
'''St. James, Smithtown,
Stony Brook, Nissequogue - New York
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
8d2e41 No.12311356
>>12311329
the only solution for misgendered is to have a lobotomy
no need to thank me for the solution, just go ahead with the procedure
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
f56d94 No.12311357
>>12311332
Gender Studies - just bring your hatred of White Men to class and you'll ace it.
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
2c08a3 No.12311358
YouTube embed. Click thumbnail to play. >>12311256
"…cook book"? See, that's a big mistake! The Bible could NOT have been constructed by human intellect…it's not possible! Scientific proof, ←– Right There!
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
dcb9e0 No.12311359
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
c6cd29 No.12311360
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
65da4c No.12311361
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
80e39c No.12311362
Mexico Offers Political Asylum to Julian Assange After UK Judge Blocks US Extradition
Mexico’s President Andres Manuel Lopez Obrador said during his daily press briefing that Mexico is prepared to offer political asylum to WikiLeaks founder Julian Assange.
The offer comes shortly after UK Judge Vanessa Baraitser denied an extradition request by the US government on the grounds that Assange would not be prevented from committing suicide in our prison system.
The US prosecutors have 14 days to appeal the judge’s decision and has said that they plan to do so.
“I’m satisfied that Mr. Assange has the intellect and determination to circumvent the suicide prevention measures, as Professor Kopelman posted, Mr. Assange would not only find a way to suicide, but he it will be executed with the single-minded determination of his ASD/Asperger’s,” the judge said in her ruling on Monday. “Facing conditions of mere total isolation, and without the protective factors which mitigate his risks at HMP Belmarsh, I am satisfied that the US procedures would not prevent Mr. Assange from committing suicide.
“For those reasons, I’ve decided that extradition would be oppressive by reason of Mr. Assange’s mental health and I order his discharge under section 91 of the extradition act 2003. The United States has 14 days to appeal,” the judge concluded.
President Obrador called for Assange to be released last January, to end his torture in detention.
“I don’t know if he has recognized that he acted against rules and norms of a political system, but at the time these cables demonstrated how the world system functions in its authoritarian nature,” Lopez Obrador said in response to a question about Assange at a regular government news briefing last year. “Hopefully consideration will be given to this, and he’s released and won’t continue to be tortured.”
Assange’s lawyers are attempting to get him released from prison now, despite the appeal window, and a bail hearing has been set for Wednesday.
https://www.thegatewaypundit.com/2021/01/breaking-mexico-offers-political-asylum-julian-assange-uk-judge-blocks-us-extradition-video/
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
50fd09 No.12311363
>>12311285
wonder if Jared's dad got a pardon so he could testify against him in court ?
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
3bb08e No.12311364
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
c960aa No.12311365
>>12311349
Man, her eyes look full of hatred.
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
1e91c9 No.12311366
>>12311242
"On his watch" ← tell tale sign of a shill
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
1c13b5 No.12311367
>>12311225
That is what I have done, and have only been told to pull it up twice. Once at a bank, and another time in a gift shop that I ended up being thrown out of anyway when they refused my disease-ridden cash and I told the woman she was crazy.
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
193173 No.12311368
>>12311204
11.780 Q as the search:
What does 11780 mean?
Definitions for 11780
11780
Here are all the possible meanings and translations of the word 11780.
Numerology
Chaldean Numerology
The numerical value of 11780 in Chaldean Numerology is: 0
Pythagorean Numerology
The numerical value of 11780 in Pythagorean Numerology is: 0
Images & Illustrations of 11780
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
aee2a0 No.12311369
>>12311330
DC COPS are always dirty sacks of shit. that has never been a secret. dont be nice to them and dont try getting photo ops while there, because they are dirty fucking cops. all of them.
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
f08cb6 No.12311370
>>12311335
The South Dakota Tyndall has two 'l's. My birth town. Population of about 200 farmers. No military base anywhere around. .
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
0170d6 No.12311371
DOW WAS DOWN ALMOST 800 POINTS TODAY
I WONDER WHAT HABBENS IF DEMOCRATS STEAL THE TWO SENATE SEATS TOMORROW??
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
f36e2d No.12311372
YouTube embed. Click thumbnail to play. Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
8d25df No.12311373
>>12311362
>Mexico Offers Political Asylum to Julian Assange After UK Judge Blocks US Extradition
notable in last bread
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
11bbac No.12311374
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
9cb40c No.12311375
>>12311281
Having the same observances since the start of COVID. It really fucked a lot of people's heads up, and @POTUS' "self-disccovery" and "Q" operation hasn't penetrated the public psyche enough. It's done a very good job, but it needs some real mainstream pushes to get people to buy it all.
This isn't going to end in the next 4 years until something very public and convincing happens. That isn't going to happen until backchannels are no longer necessary.
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
193173 No.12311376
>>12311204
11,780 Q as the search:
https://www.viator.com/tours/Mornington-Peninsula/2-hour-Snorkel-with-the-Seals/d22999-11780P9
'2 hour Snorkel with the Seals
3 Reviews
|
Sorrento, Australia
Share
from $62.64
Lowest Price Guarantee
Select Date and Travelers
Saturday, Jan 9, 2021
Number of travelers
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
d7bddf No.12311377
the biggest problem we face and will always face is the ministry of truth (mainstream news). my trump supporting relative, who for whatever reason watches nbc, is now wishing he would just shut up and let biden transition. no matter how much you try to explain to them without going too far down the rabbit hole, they don't care. the news cycle is constantly beating into your head "president elect biden's victory", "trumps disgraced loss", "debunked conspiracy theories about voting fraud", "baseless claims about vote rigging".
it will be some twilight zone shit if/when the news ever reports the truth when it starts to come out.
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
80e39c No.12311378
Project Veritas: Warnock Staff Admits Candidate’s Bias Against Police, “Police Officers Are Not All Good…Most of Them Are Bad, WE Know That”
O’Keefe strikes again!
Project Veritas released undercover video of Raphael Warnock’s staff admitting the Democrat Senate candidate’s bias against the police.
The Georgia twin senate runoff election takes place Tuesday, January 5th and the stakes could not be higher.
The Democrats are currently trying to steal both Georgia Senate seats in order to install radical leftists and take control of the Senate.
Georgia Democrat Senate candidate Raphael Warnock is a dangerous Marxist.
“Police officers are not all good, you know what I’m saying? Most of them are bad, WE know that,” Raphael Warnock’s campaign staffer Sasha Williams is heard saying on undercover audio.
Another campaign staffer said Warnock avoids using the phrase ‘defunding the police’ so he doesn’t get attacked, but his goal really is to defund the police.
“He avoids using defunding the police…in reality his whole platform is along the lines of the same people saying defund the police,” another staffer admits to Project Veritas.
WATCH:
https://www.thegatewaypundit.com/2021/01/project-veritas-warnock-staff-admits-candidates-bias-police-police-officers-not-good-bad-know-video/
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
c7ba80 No.12311379
Revisiting the Kappy Rabbit Hole…….
Isaac Kappy called out Tom Hanks of being a pedophile (Also see: @SaRaAshcraft). This blew up on the internet and even hit some mainstream news outlets…
Hanks never responded, but we all know about his creepy glove pics on Insta.
One specific post showed a picture of a glove with the caption reading:
'Historic Route 66. Roadkill? I hope not! Hanx.'
Dated April 4, 2019 - 39 days before Kappy's death……on Route 66.
Isaac Kappy "jumped" from an overpass on ROUTE 66 near Bellemont, Arizona on May 13, 2019.
The SAME day Kappy "jumped" Hanks posted the red handkerchief pic to his Insta…
A red handkerchief. Within the world of high profile occult murders/suicides, there is the ever-present theme of the “red scarf.”
High profile people are found hanged, often with red scarves, including Kate Spade and L’Ren Scott.
Coincidence it's the SAME day as Kappy's death?
Did you know that the person who hit Kappy's body was named Forest Scott Proctor. (Police Report attached as pic)
Forest???
Like, Forrest (Gump)?? On Route 66???
COINCIDENCE???
THREAD: https://twitter.com/Jhomes551/status/1346140916168404993
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
7c4441 No.12311380
>>12311371
>DOW WAS DOWN ALMOST 800 POINTS TODAY
>I WONDER WHAT HABBENS IF DEMOCRATS STEAL THE TWO SENATE SEATS TOMORROW??
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
24f8ea No.12311381
>>12308395 (pb)
>>12309896 (pb)
There is a particular dimwitten anon here that completely misunderstood my earlier post here.
I never said that footage like this does not exist.
I said learn to use your brain and exercise discernment.
Until yesterday I would have guessed LW's sauce must be solid, trust Lin. Why else would he say something like that.
But now Lin says that origin of the sauce is lizard squad, people who were convicted in the past and possibly offered leniency in return for becoming assets for our three letter agencies.
Sauce like this is either released by white hats or black hats, nothing else makes sense to me, since information like this will be well guarded. So either white hats used lizard squad -> Kappy -> LW as a vector to get it out or black hats did. In the second instance it would serve as a means to muddy the waters and introduce fake footage to discredit the real footage.
If you ask me which alternative is most likely, today I tend to chose the latter, yesterday I would have guessed the first.
Credibility is everything in information warefare, I rather exercise caution in this case.
I used to get shit from anons for pointing out that the narrative LW points out seems to be correct even if little details might be wrong (for instance whether JR's children were adopted from Wales vs. Ireland), but now I absolutely urge anons to stay extra skeptical because if all of a sudden clips emerge and it turns out they are fake, it's going to be hard to later introduce the real evidence and convince the public that this is really going on.
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
01634b No.12311382
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
4c76f7 No.12311383
>>12311314
Pretty sure it's only wasted when shills do it.
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
1894cf No.12311384
>>12311349
We don't have to mail our votes anymore, since it is safe enough for them!!
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
1e91c9 No.12311385
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
8169a2 No.12311386
>>12310905
I'm beginning to think one of the purposed for Wood's tweets is to lure out the ones having pretended to be "white hats".
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
c960aa No.12311387
>>12311350
>not to concernfag but
Proceeds to concernfag
Big brain move right there
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
0cdb7d No.12311388
>>12311370
whats underground there I wonder
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
c6cd29 No.12311389
>>12311358
Yehuda ain't so weak that he can't
manipulate a human's ways or words,
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
193173 No.12311390
>>12311204
11,780 Q as the search:
https://www.almexperts.com/images/Photoweb/140991_11780_11G_25085_ResumePath.pdf
RONALD G. QUINTERO, CPA, CFA, ABV, CDBV, CFE,
CFF, CIRA, CMA, CTP
Managing Director • Chartered Capital Advisers, Inc.
245 Park Avenue, 39th Floor • New York, NY 10167
(212) 327-0200 • (212) 327-0225 FAX • q@charteredcapital.com
www.charteredcapital.com
Professional Activities
Served more than 750 public and private clients
of all sizes in a broad range of industries
Areas of Expertise
Valuations of businesses, financial instruments, and
intangible assets
Italian Holiday Voucher Boosted Domestic Tourism | .TR
Search domain www.tourism-review.com/holiday-voucher-boosted-domestic-tourism-in-italy-news11780https://www.tourism-review.com/holiday-voucher-boosted-domestic-tourism-in-italy-news11780
Domestic tourism supported by holiday voucher in Italy. In a summer that has been further from typical due to the coronavirus pandemic, Italy has been able to boost domestic demand in an effort to offset the drop in international arrivals.
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
8169a2 No.12311391
>>12311386
meant "purposes"
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
99d200 No.12311392
>>12310788
Thank You Baker!
o7
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
e4ff8c No.12311393
>>12310159 lb
Is the hacked Comet Ping Pong menu real?
Legitimate sauce for it?
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
1ed846 No.12311394
OTD
Crossed swords
in 1878 the
Flag of Russia
Russian Army liberated #Sophia
Flag of Bulgaria
from #Ottoman troops.
The citizens of the #Bulgarian capital met #Russians with enthusiasm. The liberation of Sophia brought the #Slavic nations closer to the long-sought freedom from the Ottoman yoke
https://twitter.com/mfa_russia/status/1346072515303657472
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
e1d914 No.12311395
Night Shift work.
Asking for moar names.
Good or Bad?
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
4b1a9a No.12311396
The covid lockdowns were to condition normies, and put everything in place, for the martial law that will be needed when half of Congress is arrested; yes or no?
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
2fbba3 No.12311397
YouTube embed. Click thumbnail to play. Deep fakes just mentioned on the floor of the House
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
aee2a0 No.12311398
>>12311274
or right about Jared. have we not learned anything from the jew shill, we do know that there is no denying that they stick together in the destruction of the "goy" of that I am sure. I HOPE she is wrong about Kushner. I do try to like him and the more I watch his interviews, I think I do like him.
but still. be cautious
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
f56d94 No.12311399
>>12311350
> A LOT of people just jumping ship and saying "OH WELL, yeah he stole it, but what can we do about it."
BLACKPILL: many such cases
I'm experiencing the same thing, Anon.
The Precipice is super narrow af at this point - something has to break soon.
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
42e15f No.12311400
>>12311348
What state anon? Did the same in my area. My bro is a pastor went to the school and used this as a pretense to set up a Christian club. Eventually the satan club was BTFO. Christian club remains.
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
299b63 No.12311401
>>12311349
>>12311364
NPC escapee from DOOM v1.21
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
a3f4a4 No.12311402
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
a29ff6 No.12311403
BREAKING: Mexico Offers Political Asylum to Julian Assange After UK Judge Blocks US Extradition (VIDEO)
https://www.thegatewaypundit.com/2021/01/breaking-mexico-offers-political-asylum-julian-assange-uk-judge-blocks-us-extradition-video
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
3bb08e No.12311404
>>12311379
k. so.
if the death of that young man who worked for Loefller was a hit, isn't Wood concerned?
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
393213 No.12311405
>>12311362
Trump's biggest stain was not pardoning this fellow.
disgusting.
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
193173 No.12311406
>>12311204
11,780 Q as the search:
https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=PRK11780
Conserved Protein Domain Family
PRK11780
Entrez CDD Structure Protein Help
COVID-19 is an emerging, rapidly evolving situation.
Get the latest public health information from CDC: https://www.coronavirus.gov
Get the latest research information from NIH: https://www.nih.gov/coronavirus
Find NCBI SARS-CoV-2 literature, sequence, and clinical content: https://www.ncbi.nlm.nih.gov/sars-cov-2/
?
PRK11780: PRK11780 Download alignment
isoprenoid biosynthesis glyoxalase ElbB
Links?
Source: PRK
Taxonomy: Bacteria
Protein: Representatives
Specific Protein
Related Protein
Related Structure
Architectures
Superfamily: cl00020
Statistics?
Structure?
PRK11780 is a member of the superfamily cl00020.
Sequence Alignment
include consensus sequence ?
Format:
Hypertext
Row Display:
up to 10
Color Bits:
2.0 bit
Type Selection:
the most diverse members
225630924 11 KLKAAVVLSGCGHLDGVEVREAVLSLLVLDQQEVDVKCFAPDINITQVMNHRTKEATK-EK-RNVLVEAARIARGEIYDL 88
299768483 1 MKKVAVILSGCGYLDGSEIRESVLTLLALDTANIEYQIFAPDEPLFHVIDHVSGEINMtER-RNILQEAGRIARGEIFSL 79
126643263 1 -----------–MtER-RNILQEAGRIARGKISSL 22
184159767 1 MKKVAVILSGCGYLDGSEIRESVLTLLALDTVNIEYQIFAPDEPLFHVIDHVSGEINMtER-RNILQEAGRIARGKISSL 79
269958346 1 -MNCAVLLSGCGHMDGSEIRESVLVLLELDRLGVRFQCCAPDIQQCDVVNHVSKSSES-QTaRNILVESARIARGDIVNI 78
56417264 1 -MNCVVLLCGCGHMDGSEVRESVLVLLELDRLGVKFQCCAPDIQQHDVVNHASKSTEN-QT-RNILAESARIARGEVISI 77
222475628 1 -MNCVVLLCGCGHMDGSEVRESVLVLLELDRLGVKFQCCAPDIQQHDVVNHASKSTEN-QT-RNILAESARIARGEVISI 77
88606844 1 -MNCAVLLCGCGHMDGSEIREAVLALLALDSYGINVTCCAPNIKQVDVVDHLSGSTLE-EE-RDIMSESARIARGNVVDP 77
42522181 1 MKKIAVVLSGCGHRDGSEITESVSLLIGLHQAGAEVHCFAPDI-QIPITNHINGEAQG-EK-RSLLTEAARIARGHIQSL 77
239617221 1 -MKAGILLSGCGLGDGTQIEEVMLTYLSLDKYGIDYITFAPNEMQHDVIDHYTEKPQN-EK-RNILIESARIGRGKICDI 77
225630924 89 KEAKAENFDMLVVPGGYGVAKNLSDLAESKDMVTVMPEFERLVSEFFVTKKPIGAICISPAIIVSILsskigkeE-SKVK 167
299768483 80 NQLNENEFDGLLLPGGFGVAKNLSTFAFKGAEARVHSTVASILKAFHQSKKPIGAICISPALLALTF-–GdLHPN 152
126643263 23 DQLNENEFDGLILPGGFGVAKNLSTFAFKGAEARVHGTVASILKAFHQSKKPIGAICISPALLALTF-–GeLHPT 95
184159767 80 DQLNENEFDGLILPGGFGVAKNLSTFAFKGAEARVHGTVASILKAFHQSKKPIGAICISPALLALTFg-eL–HPT 152
269958346 79 KSLRVHEFDMLIVPGGFGVAKNFSNLVSQSGSVVVEDDVNSLIREFHRVRKAIGGVCIAPAIIAAALs--ElVKVK 152
56417264 78 ERVQVHEFDMLIVPGGFGVAKNFSNLVSQSGPVSVIDSVKGLIHQFHRARKAIGGVCIAPAVIAAALs--ElVKVK 151
222475628 78 ERVQVHEFDMLIVPGGFGVAKNFSNLVSQSGPVSVIDSVKGLIHQFHRARKAIGGVCIAPAVIAAALs--ElVKVK 151
88606844 78 KDISPNDFDMLILPGGFGVAKNYSDILKGESPVSVLEEVKQTIVKFHKEKKAIGAICIAPAIVAASLs--SvSKVK 151
42522181 78 DKLHAKDFDAVVFPGGYGAAKNLSNWAEKGAQCEVNPDVKRVILEFHSASKPIGALCIAPVLVAKVLg-dK–KVT 150
239617221 78 REVSCKDIDAIIIPGGLGVFKNLSTFIVDKKSFTVNKNVDDLLKAMYLSKKSIAGICGAVILIAKSLs-qH–VSD 150
225630924 168 VTIG—DDREQLIERLGGEHIKCDTELSIEDEEHNVFSCSAYMRSDeST-YSVYQGIKHMIDSMVKKI 232
299768483 153 ITLGs-dVNTAKEIEKTGSIPHVCQTSSCVVDKQNLFVTTPAYMDDQaGL-KDVFLGITSLVTAMTILA 219
126643263 96 ITLGs-dLNIAKEIEKTGSIHHVCQTSDCVVDKQNLFVTTPAYMDDQaNL-KDIYTGITSLVNTMTALA 162
184159767 153 ITLGs-dLNIAKEIEKTGSIHHVCQTSSCVVDKQNLFVTTPAYMDDQaNL-KDIYAGITSLVNTMTALA 219
269958346 153 VTLG—DDTDGIISRCGGEHVVCPTDGFVVDEENAVFSCSAYMRDD-RL-HRVHLGIQKMVEGMVKFC 216
56417264 152 VTLG—DDADGIISRCGGEHVVCPTDDFVADEKNAVFSCSAYMRDD-TL-HRVHLGIQKMVEGMVKFC 215
222475628 152 VTLG—DDADGIISRCGGEHVVCPTDDFVADEKNAVFSCSAYMRDD-TL-HRVHLGIQKMVEGMVKFC 215
88606844 152 VTLG—EDIDSIISRCGGEHVFCETDDYVADIDMGVFSTPAYMRKD-SL-HKIHVGIHKMVGAMVDFV 215
42522181 151 VTIGd-dAATAAEIEKTGAIHEECPVNDYITDRESKVVTTPAYMYGD-AKpNEVFAGIFGLAHEIVEWA 217
239617221 151 LKVAtanDAYGELLSELNVNAVNCSAKECVIDRKKQSSNYP-RI—SGIQKNGRNYGGY- 206
Citing CDD
Lu S et al.(2020). "CDD/SPARCLE: the conserved domain database in 2020.", Nucleic Acids Res. 48(D1):D265-D268.
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
f08cb6 No.12311407
>>12311230
Used to be a shitload of Cold War nuclear missile silos in the Tyndall, SD area. Most were emptied out and bought by locals for groovy homes.
There is NOTHING around Tyndall but cornfields and occasional farmhouses.
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
65f0b3 No.12311408
>>12311242
You do realize everyone is just filtering you, right?
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
c6cd29 No.12311409
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
b157a2 No.12311410
>>12311379
Red scarf goes way back
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
80e39c No.12311411
Congress Approves Rules Regulating Jan. 6 Electoral Vote Count
The House of Representatives and the Senate on Sunday adopted rules that outline how the counting of Electoral College votes will take place on Jan. 6.
The rules were passed without recorded votes. Instead, a voice vote was used in both chambers.
The guidance, introduced by Senate Majority Leader Mitch McConnell (R-Ky.), says the chambers will meet in a joint session on Jan. 6 presided over by Vice President Mike Pence.
Pence, as president of the Senate, will open “all the certificates and papers purporting to be certificates of the electoral votes,” the rules state, a nod to how seven states sent so-called competing electors, or certificates for both Democratic presidential nominee Joe Biden and President Donald Trump, to Washington.
The certificates and papers will be opened, presented, and acted upon in alphabetical order, starting with Alabama.
This is when dozens of Republicans—50 representatives and 12 senators, according to an Epoch Times tally—are planning to object to some certificates, alleging election irregularities including voter fraud and failure to follow state election laws.
That will trigger a withdrawal from the joint session and a two-hour debate, followed by votes in each chamber. Only with a majority vote from both the House and the Senate would a challenge be upheld, which even supporters find unlikely, considering Democrats who control the House and Senate Republican leadership, including McConnell, have expressed disapproval with the plan to object.
House Speaker Nancy Pelosi (D-Calif.) in a letter to colleagues on Sunday noted that objections can happen but said, at the end of the day, Biden “will be officially declared the next president.”
“On Monday, we will have a clearer picture of how many state votes will be subject to an objection. Our choice is not to use the forum to debate the presidency of Donald Trump,” she added.
Reps. Ron Estes (R-Kan.), Tracey Mann (R-Kan.), and Jacob LaTurner (R-Kan.) said Sunday they will join in the objections, saying in a statement that several states are “facing serious allegations of voter fraud and violations of their own state law.”
“This action is not taken lightly and comes after extensive study and research. Kansans deserve to know that all legal, and only legal, votes were counted. We hope our actions begin to restore the confidence of tens of millions of our fellow Americans that feel their sacred right to vote is under attack,” they added.
Reps. Jim Jordan (R-Ohio) and Richard Hudson (R-N.C.) also announced Sunday they’ll object.
https://www.theepochtimes.com/congress-approves-rules-regulating-jan-6-electoral-vote-count_3642381.html
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
748849 No.12311412
>>12311300
Infiltration at the highest levels of government, media, science, health,military CoC
Newfags think they're smart but they ain't
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
0ddfc2 No.12311413
>>12311349
That thing has more testosterone than the whole shiff clan combined.
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
cd252c No.12311414
Q-day 1165 (6+5=11)… 11:11
1-4 (four 1's)… 11:11
2021 (four 1's)… 11:11
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
a29ff6 No.12311415
>>12311402
it's WED but you're on a roll
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
83a1be No.12311416
>>12311321
>go "san francisco" style
PAL-in-DROME
[123] 11 [321]
6 2 6
QDrop# 626 (14) (5)
01/27/2018 12:34:38
Chatter exploding.
Change of narrative will be required.
[-4][-5]
Public to awaken [mass-start].
Sleeping pill reject.
OP Mockingbird FAILURE.
FAKE>REAL.
BLIND>20/20.
KILL_CHAIN.
Where we go one, we go ALL>
Q
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
beff4d No.12311417
>>12311132
Anon has heard that it's better to park and ride from VA or MD.
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
4b1a9a No.12311418
>>12311394
They went from one yoke to another
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
1eb496 No.12311419
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
b0799f No.12311420
Oct 21 2020
4930
Q !!Hs1Jq13jV6 ID: 996755 No.11203025 📁
Oct 21 2020 21:48:02 (EST)
https://www.fbi.gov/about/leadership-and-structure/fbi-executives/kohler📁
Q
4929
Q !!Hs1Jq13jV6 ID: 996755 No.11202919 📁
Oct 21 2020 21:45:15 (EST)
https://www.fbi.gov/about/leadership-and-structure/fbi-executives/tyson📁
Q
4928
Q !!Hs1Jq13jV6 ID: 996755 No.11202817 📁
Oct 21 2020 21:42:46 (EST)
Bishop.jpg⬇
4927
Q !!Hs1Jq13jV6 ID: 996755 No.11202692 📁
Oct 21 2020 21:40:02 (EST)
David_Bowdich.jpg⬇
4926
Q !!Hs1Jq13jV6 ID: 996755 No.11202551 📁
Oct 21 2020 21:36:32 (EST)
Haspel.jpg⬇
Non_CIA_background next?
Q
4925
Q !!Hs1Jq13jV6 ID: 996755 No.11202412 📁
Oct 21 2020 21:32:59 (EST)
EdWDTBXVcAAwnm0.png⬇
4924
Q !!Hs1Jq13jV6 ID: 292db4 No.11202027 📁
Oct 21 2020 21:21:53 (EST)
BOOMS EN_ROUTE TOMORROW.
This is not a drill.
Q
4923
Q !!Hs1Jq13jV6 ID: 12e944 No.11201288 📁
Oct 21 2020 20:55:05 (EST)
https://twitter.com/VRSVirginia/status/1319071346282778624📁
Dearest Virginia -
We stand with you.
Now and always.
Find peace through prayer.
Never give up the good fight.
God bless you.
Q
4922
Q !!Hs1Jq13jV6 ID: 7769ae No.11200840 📁
Oct 21 2020 20:32:00 (EST)
https://www.foxnews.com/politics/laptop-hunter-biden-linked-fbi-money-laundering-probe📁
Q
4921
Q !!Hs1Jq13jV6 ID: 7769ae No.11200116 📁
Oct 21 2020 19:58:40 (EST)
Ek4G8urXIAEKasf.jpg⬇
4920
Q !!Hs1Jq13jV6 ID: 7769ae No.11200113 📁
Oct 21 2020 19:58:24 (EST)
Do you remember when #MeToo lost all credibility when they refused to support Tara Reade coming forward re: claims of sexual assault by Joe Biden?
Political movement?
Q
4919
Q !!Hs1Jq13jV6 ID: fb3dc6 No.11199550 📁
Oct 21 2020 19:31:51 (EST)
https://twitter.com/WarRoomPandemic/status/1319022578002964485📁
Client?
Political pundit [pollster] for sale?
Do you see how it works?
ENEMY OF THE PEOPLE.
Q
4918
Q !!Hs1Jq13jV6 ID: 724ac8 No.11197253 📁
Oct 21 2020 17:43:55 (EST)
EMAqDm9UUAE3wDQ.png⬇
ELT3m8uXYAAWTPV.jpg⬇
4917
Q !!Hs1Jq13jV6 ID: a48b57 No.11193377 📁
Oct 21 2020 14:06:39 (EST)
https://twitter.com/ChanelRion/status/1318931828481400833📁
Underage family member?
FBI can no longer attempt to shelter [protect] the Biden's?
Public awareness kills all protections.
Q
4916
Q !!Hs1Jq13jV6 ID: a48b57 No.11193181 📁
Oct 21 2020 14:01:21 (EST)
https://nypost.com/2020/02/03/joe-biden-kisses-granddaughter-on-lips-during-iowa-rally/📁
Inappropriate [sick] to you?
Normal to them?
Dark secrets.
Q
4915
Q !!Hs1Jq13jV6 ID: a48b57 No.11193040 📁
Oct 21 2020 13:56:57 (EST)
A deep dark world is being exposed.
The truth won't be for everyone.
Have faith in Humanity.
Q
4914
Q !!Hs1Jq13jV6 ID: a95dd3 No.11192967 📁
Oct 21 2020 13:54:01 (EST)
Dkrr0VeXgAArTN3.jpg⬇
4913
Q !!Hs1Jq13jV6 ID: a95dd3 No.11192896 📁
Oct 21 2020 13:52:14 (EST)
EJ380AEUcAAfI_w.jpg⬇
4912
Q !!Hs1Jq13jV6 ID: a95dd3 No.11192872 📁
Oct 21 2020 13:51:40 (EST)
D0MMzlYX4AEDm_u.jpg⬇
4911
Q !!Hs1Jq13jV6 ID: a95dd3 No.11192741 📁
Oct 21 2020 13:48:03 (EST)
7ey66blhcww31.jpg⬇
4910
Q !!Hs1Jq13jV6 ID: a95dd3 No.11192736 📁
Oct 21 2020 13:47:34 (EST)
Anonymous ID: 4e0898 No.11192597 📁
Oct 21 2020 13:43:52 (EST)
>>11192505
So many people refuse still to admit the evils in the world. They're going to need to see a lot more.
>>11192597
Freedom of information [truth] = END
Q
4909
Q !!Hs1Jq13jV6 ID: a95dd3 No.11192602 📁
Oct 21 2020 13:43:55 (EST)
democrat_party_crumbling_held_up_by_cnn_msnbc_cbs_nyt.jpg⬇
4908
Q !!Hs1Jq13jV6 ID: a95dd3 No.11192505 📁
Oct 21 2020 13:41:31 (EST)
The_Great_Awakening_Crowd_Meme_570x350.jpg⬇
Sometimes you can't TELL the public the truth.
YOU MUST SHOW THEM.
ONLY THEN WILL PEOPLE FIND THE WILL TO CHANGE.
Crimes against children unite all humanity [cross party lines]?
Difficult truths.
Q
Lin Wood
@LLinWood
·
10h
I believe Chief Justice John Roberts & a multitude of powerful individuals worldwide are being blackmailed in a horrendous scheme involving rape & murder of children captured on videotape.
I have the key to the files containing the videos. I have also shared this information.
https://mobile.twitter.com/LLinWood/status/1345991175690457091
Get it yet?
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
9cb40c No.12311421
>>12311404
I don't know, is he? Was the hit against that kid, or someone close to him?
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
193173 No.12311422
>>12311204
WHAT IS THIS?
COMES UP WHEN SEARCHING 11,780 Q
https://pubs.acs.org/doi/10.1021/ja204289q
ACS is committed to helping combat the global COVID-19 pandemic with initiatives and free resources. Learn More
From Highly Enantioselective Catalytic Reaction of 1,3-Diynes with Aldehydes to Facile Asymmetric Synthesis of Polycyclic Compounds
Mark Turlington, Yuhao Du, Samuel G. Ostrum, Vishaka Santosh, Kathryne Wren, Tony Lin, Michal Sabat, and Lin Pu*
View Author Information
Cite this: J. Am. Chem. Soc. 2011, 133, 30, 11780–11794
Publication Date:June 20, 2011
https://doi.org/10.1021/ja204289q
Copyright © 2011 American Chemical Society
RIGHTS & PERMISSIONS
Abstract
Abstract Image
(S)-1,1′-Binaphth-2-ol (BINOL) in combination with ZnEt2, Ti(OiPr)4, and biscyclohexylamine was found to catalyze the highly enantioselective (83–95% ee) addition of various 1,3-diynes to aldehydes of diverse structures. This method provides a convenient pathway to generate a number of optically active dienediynes as the acyclic precursors to polycyclic compounds. The chiral dienediynes undergo highly chemoselective Pauson–Khand (PK) cycloaddition in benzaldehyde by using [Rh(cod)Cl]2 as the catalyst in the presence of rac-BINAP. High diastereoselectivity (up to >20:1) has also been achieved with the chiral dienediyne substrates containing a bulky substituent adjacent to the chiral center. In the presence of the Grubbs II catalyst, ring-closing enyne metathesis of the PK cycloaddition products led to the formation of the desired 5,5,7- and 5,5,8-fused tricyclic compounds. Further highly diastereoselective Diels–Alder reaction of a 5,5,7-tricyclic compound with maleic anhydride produced a 5,5,7,6-polycyclic product. The asymmetric synthesis of polycyclic compounds from optically active dienediynes has established a novel and efficient synthetic route to the structural framework of many biologically significant molecules.
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
782bef No.12311423
make yourslef heard at DOJ.
Report election crime using the proof you know about. Yes they know we know, and we know that they know, but maybe flooding them will get the point across.
https://www.justice.gov/actioncenter/report-crime
Or write the DOJ ( not report a crime) and tell them to investigate the voter fraud seriously instead of dismissing it.
https://www.justice.gov/contact-us
Or call them.
Home
Contact the Department
Messages to the Department of Justice, including the Attorney General, may be sent using this form. Your message will be forwarded to the responsible Department of Justice component for appropriate handling.
Contact Us Form
Other Correspondence
Correspondence to the Department, including the Attorney General, may be sent to:
U.S. Department of Justice
950 Pennsylvania Avenue, NW
Washington, DC 20530-0001
The Department may be contacted by phone at the following:
Department Comment Line: 202-353-1555
Department of Justice Main Switchboard: 202-514-2000
TTY/ASCII/TDD: 800-877-8339 (or Federal IP Relay Service)
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
3bb08e No.12311424
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
80e39c No.12311425
Israeli PM Netanyahu claims Iran's uranium enrichment to 20 percent is bid to develop nukes
Prime Minister of Israel Benjamin Netanyahu has accused Iran of working to develop nuclear weapons, after Tehran claimed on Monday that it has resumed uranium enrichment to the 20-percent level at its Fordo site.
"Iran's decision to continue violating its commitments, to increase the level of enrichment and advance its abilities to enrich uranium underground cannot be explained in any way other than the continued implementation of its intention to develop a military nuclear program," Netanyahu said in a statement.
A spokesperson for the Iranian government, Ali Rabiei, told the Mehr News Agency on Monday that Tehran was pursuing uranium enrichment to a purity of 20 percent, which is lower than the 90 percent weapons-grade level, but is still a breach of the 2015 JCPOA nuclear deal.
Last month President Hassan Rouhani accused of Israel of being behind the assassination of top Iranian nuclear scientist Mohsen Fakhrizadeh, who was killed in late November 175 kilometers from Tehran.
Earlier in November, Netanyahu had warned against Iran's nuclear program, urging against any return to the nuclear deal abandoned by US President Trump in 2018, and instead calling for an "uncompromising policy to ensure that Iran does not develop nuclear weapons."
The Israeli PM has previously given elaborate presentations on what he said is Iran's secret "nuclear weapons development site" at Abadeh in the south of the country.
https://www.rt.com/news/511487-netanyahu-iran-enrichment-nuclear-weapons/
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
62d21b No.12311426
>>12310888
He’s certainly not getting one from you.
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
425134 No.12311427
>>12311321
>can always go "san francisco" style
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
a29ff6 No.12311428
>>12311412
just proves you don't have a fucking clue, cunt.
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
393213 No.12311429
>>12311371
IF?
they will steal them and stocks (eventually) will have a blow-off top until the $ collapses.
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
a1b27b No.12311430
>>12311369
Most cops are GOOD PEOPLE.
Your post is consistent with fomenting Democrat narrative of anti-police.
Oh and look, right before Jan 6 party in DC.
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
193173 No.12311432
>>12311204
11,780 Q search:
https://share.hsforms.com/11780UBPxQ0GMhNXFrT_J_Q3n0p2
Request AJIC abstract article on "Light-guided nudging and data-driven performance feedback improve hand hygiene compliance among nurses and doctors"
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
b0799f No.12311433
>>12311420
Oops sorry. Don't know how that happened.
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
399f8e No.12311434
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
75f797 No.12311435
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
9cb40c No.12311436
>>12311405
>was not pardoning this fellow
Like you know better than @POTUS on when/who to pardon?
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
023118 No.12311437
>>12310863
The mayor didn't write that. It was the (((Legal Counsel))) of the Mayor who wrote it.
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
193173 No.12311438
>>12311204
11,780 Q search:
VAX - Wikipedia
Search domain en.wikipedia.org/wiki/VAXhttps://en.wikipedia.org/wiki/VAX
VAX is a line of superminicomputers and workstations developed by the Digital Equipment Corporation (DEC) in the mid-1970s. The VAX-11/780, introduced October 25, 1977, was the first of a range of popular and influential computers implementing the VAX instruction set architecture (ISA). Over 100 models were introduced over the lifetime of the design, [citation needed] with the last members …
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
07d1f1 No.12311439
>>12311374
wtf with the last sentence?
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
dcb9e0 No.12311440
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
8bd541 No.12311441
YouTube embed. Click thumbnail to play. Lauren Boebert, New Queen of Congress
‘It is my responsibility to object to electoral vote’
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
193173 No.12311442
>>12311204
11,780Q search:
SANTA CLARITA COMES UP
https://www.santa-clarita.com/home/showdocument?id=11780
Emergency Checklist Flyer 2016 - Santa Clarita, California
Search domain www.santa-clarita.com/home/showdocument?id=11780https://www.santa-clarita.com/home/showdocument?id=11780
q First aid kit, freshly stocked q First aid book q Food q Adjustable wrench for turning o˚ gas q Can opener (non-electric) q Blankets or sleeping bags q Portable radio, flashlight, and spare batteries q Sturdy shoes q Heavy gloves to clear debris q Duct tape, plastic sheeting q Light sticks q Whistle q Essential medications q Extra pair of …
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
0ddfc2 No.12311443
>>12311378
I wonder what police officers are like in the congo? I'll pay for the one way ticket.
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
393213 No.12311444
>>12311378
the nigglet is right on this one.
most cops are scum, I know that too.
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
99d200 No.12311445
>>12310834
This technique was used widely in Iraq and Afghanistan during the Wars. Dates back decades however. Round the same time Sicilians lit cats on fire to burn down forests…
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
b57ae4 No.12311446
Does anyone remember what the date was of that strange announcement at Denver Airport? Anyone have the vid?
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
841da3 No.12311447
>>12311399
My teen said they should rock paper scissors for it
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
dcb9e0 No.12311448
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
8d25df No.12311449
Notables Are Not Endorsements
#15715
>>12310914 Bobby Piton insinuating a fake MSM hit piece coming out on him
>>12310905, >>12310924 John Cardillo is unhinged because of Lin Wood
>>12310973 It’s a Planned Panic-demic.`
>>12311007, >>12311010 Shadow strike.
>>12311080 Cheap hair lice drug may cut risk of COVID-19 death by 80 percent: study
>>12311089 How the fake news industry manufactures hoaxes
>>12311096, >>12311139 The 1973 Home Rule Act
>>12311098, >>12311411 Congress Approves Rules Regulating Jan. 6 Electoral Vote Count
>>12311160 Mayor BOWSER has no authority over DC NG. That power belongs to President Trump only due to DC's unique status.
>>12311215 Video Of Dems Objecting to Electoral College Votes
>>12311229, >>12311284 Anon advice DC Travel
>>12311295 Georgia secretary of state's office to hold press conference Monday at 3 P.M.
>>12311378 Project Veritas: Warnock Staff Admits Candidate’s Bias Against Police
>>12311379, >>12311410 Isaac Kappy revisited
>>12311423 Make yourself heard at DOJ.
>>12311425 Netanyahu claims Iran's uranium enrichment to 20 percent is bid to develop nukes
>>12310921, >>12311021 pf
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
a29ff6 No.12311450
>>12311439
*know
got it now?
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
ba7d7e No.12311451
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
1ed846 No.12311452
JUST IN: Two House Democrats ask FBI Director to open "immediate criminal investigation" into Trump
https://twitter.com/thehill/status/1346145646760366083
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
c960aa No.12311453
>>12311435
I hope to see my dear friend again
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
b0799f No.12311454
Q !!Hs1Jq13jV6 ID: a95dd3 No.11192505 📁
Oct 21 2020 13:41:31 (EST)
The_Great_Awakening_Crowd_Meme_570x350.jpg⬇
Sometimes you can't TELL the public the truth.
YOU MUST SHOW THEM.
ONLY THEN WILL PEOPLE FIND THE WILL TO CHANGE.
Crimes against children unite all humanity [cross party lines]?
Difficult truths.
Q
I believe Chief Justice John Roberts & a multitude of powerful individuals worldwide are being blackmailed in a horrendous scheme involving rape & murder of children captured on videotape.
I have the key to the files containing the videos. I have also shared this information.
https://mobile.twitter.com/LLinWood/status/1345991175690457091
Try again… Kek.
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
ecda78 No.12311455
>>12311253
They're the most dangerous because they have absolutely nothing to live for
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
f08cb6 No.12311456
>>12311388
Used to be a bunch of underground nuclear missile silos during Cold War all through the Dakota's.
4 miles NNE of Tyndall, SD is a fuckin cornfeild as far as you can see. Ain't nothing out there above ground. And most of the missile silos were emptied out, imploded or sold to locals for art noveau homes.
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
bb57a4 No.12311457
https://factba.se/topic/calendar
POTUS schedule.
President Trump will work from early in the morning until late in the evening. He will make many calls and have many meetings. The President will depart the White House at 6:10PM for a victory rally in Dalton, GA.
The White House
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
fd75bf No.12311458
>>12311445
slandering Sicily, a multi ethnic nation, on the behavior of a few idiots generations ago . . .
points off.
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
088e17 No.12311459
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
dcb9e0 No.12311460
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
e1d914 No.12311461
>>12311403
so he should be freed now.
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
8d2e41 No.12311462
>>12311355
117th 80th street
bourne
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
022f3c No.12311463
>>12311452
Impeachment Part Deux
Enjoy the show.
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
2234b7 No.12311464
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
8b0e47 No.12311465
>>12311083
>CSC CORPORATE DOMAINS, INC.
https://www.cscdbs.com
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
ba7d7e No.12311466
>>12311366
On Trump watch, the FED got eaten by the Treasury.
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
393213 No.12311467
>>12311436
I'm not saying Trump's dumb…..
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
11ad7c No.12311468
>>12311379
it's a just bullshit
The time of wild accusations is over
Proof or it didn't happen
Lin Wood will not be releasing any proof
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
193173 No.12311469
>>12311204
using 11,780 Q as the search:
read this PDF is POTUS showing us something related to the steal of the votes?:
her is just a bit of it:
http://www.vmware.structuredchannel.com/sw/swchannel/CustomerCenter/documents/11780/31589/Horizon_FAQ_-_EN.pdf
Q. What is VMware Horizon?
A. VMware Horizon® is a family of desktop and application
virtualization solutions designed to deliver Windows and
online services from any cloud. With Horizon, VMware
extends the power of virtualization—from data centers to
devices—to deliver desktops and applications with great
user experience, closed-loop manageability, and hybridcloud flexibility.
VMware Horizon 6
Q. What is Horizon 6?
A. Horizon 6 allows IT to deliver virtual or remoted desktops and
applications through a single platform to end users. These
desktop and application services—including RDS hosted apps,
packaged apps with VMware ThinApp®, SaaS apps, and even
virtualized apps from Citrix—can all be accessed from one unified
workspace to provide end users with all of the resources they
want, at the speed they expect, with the efficiency business
demands. Horizon 6 is available in three editions:
Desktops and Applications Delivered Through a
Single Platform
Deliver virtual or remoted desktops and applications through
a single platform to streamline management, easily entitle end
users, and quickly deliver Windows desktops and applications
to end users across devices and locations.
Unified Workspace with Great User Experience
With Horizon 6, IT can deliver desktops and applications to
end users through a unified workspace with Blast Performance
to enable consistently great experiences across devices,
locations, media, and connections.
Applications that can be delivered and accessed through the
unified workspace include:
• XenApp 5.0 and later
• Microsoft RDS-hosted apps and desktops for Windows
Server 2008 and later
• SaaS applications
• ThinApp 5.0 and later
• DaaS desktops and applications
• End users can also use single-sign on (SSO) from their
Unified Workspace Web app portal to sign in to AirWatch
Web Secure Content Locker and to enroll their devices if
Closed-Loop Management and Automation
Horizon 6 ensures that IT can consolidate control, automate
delivery, and protect user compute resources.
Q. What is real-time application delivery?
A. Real-time application delivery allows IT to deliver applications
and data to any number of virtual machines in seconds.
Applications are stored in shared VMDK read-only virtual disks
that instantly attach to VMs by users, groups, or devices. These
applications perform like natively installed applications for end
users providing a seamless desktop experience. App Volumes
is supported in Horizon Enterprise editions
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
193173 No.12311470
>>12311469
>>12311204
VMware, Inc. 3401 Hillview Avenue Palo Alto CA 94304 USA Tel 877-486-9273 Fax 650-427-5001 www.vmware.com
Copyright © 2015 VMware, Inc. All rights reserved. This product is protected by U.S. and international copyright and intellectual property laws. VMware products are covered by one or more patents listed
at http://www.vmware.com/go/patents. VMware is a registered trademark or trademark of VMware, Inc. in the United States and/or other jurisdictions. All other marks and names mentioned herein may be
trademarks of their respective companies. Item No: VMW5708-FAQ-HORZN-USLET-116
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
65da4c No.12311472
>>12311414
And your post # has 4 1's
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
dde3d4 No.12311473
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
c6cd29 No.12311474
>>12311385
a local bulldog I had probs w,
he's a wrench on bikes too,
my wild mind, him as th new boss
at OCC,
th old man ripped w rage,
th guy' tag is big dog,
th old man, I don't see no big dog I see a skinny puppy,
nothing but fights since th new management on OCC,
an adult swim you needa be over 90 years old just cuz th rudest th shit,
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
9eaf72 No.12311475
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
f56d94 No.12311476
>>12311468
>Proof or it didn't happen
Pretty much.
>Lin Wood will not be releasing any proof
The jury's still out on that one.
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
56a3e9 No.12311477
>>12311379
M'ber, the searches were done on yandex.
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
fd75bf No.12311478
>>12311469
provides a definition of 'Real Time' in an odd and new context, dissassciated from it's use traditionally to specify a particular type of control plane for use in . . . specialized applications of critical infrastructure.
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
9cb40c No.12311479
>>12311467
Good. Assange will get his "pardon" when it's his fucking turn.
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
b57b27 No.12311480
>>12311452
Little do they yet know that they're the ones actually under investigation.
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
9a3f48 No.12311481
>>12310886
Extraordinary My Ass
They are all Deep State civilian pol hacks with the exception of Mattis who I still believe is very much part of the Plan:
Dick Cheney, William Perry, Donald Rumsfeld, William Cohen, Robert Gates, Leon Panetta, Chuck Hagel, Ash Carter, James Mattis and Mark Esper.
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
127ae9 No.12311482
>>12311253
I’m not concerned what they look like. I gun them down, search their bodies for things I can use, kick them in the head and move on to the next.
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
a29ff6 No.12311483
>>12311403
🎗
Christine Assange #FreeAssangeNOW
@MrsC_Assange
Thank you #TeamAssange…
Its not over till hes safely home & all charges dropped, but today was the best news..
Its been 10 long traumatic years..
I hope I will hold my son again soon..like I did here in 2010
https://twitter.com/MrsC_Assange/status/1346070304464900097
WRWY Julian & Christine
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
19b952 No.12311484
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
393213 No.12311485
>>12311441
One day in, and I'm sure she's already bought and paid for, just like the others.
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
56c68e No.12311486
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
c67db6 No.12311487
>>12311375
Q actually introduced very little that wasn't already common knowledge among the "conspiracy theorist" types, what this little experiment was successful at the most was getting this knowledge out to a wider audience. Moms on twitter didn't know about Epstein blackmail rings and how to follow the paper trails of corrupt politicians 5 years ago, now it's all they talk about. This has given a lot of people their first taste of just how unwell our world truly is.
However, you are correct in that it isn't enough. People, when faced with a reality-shattering lie, automatically try something just as believable to make their transition out of the lie easier. Usually it's another lie. Many lack discernment still, and take people like Lin Wood at their word because hey, he's telling me what I want to hear so what's the harm?
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
bb57a4 No.12311488
YouTube embed. Click thumbnail to play. Gotta post this all day long.
https://nationalfile.com/georgia-raffensperger-begged-for-100-chinese-to-vote-for-him-by-mail-in-2015-won-by-159-votes/
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
dcb9e0 No.12311489
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
8d2e41 No.12311490
>>12311452
swallowsccpleiuwell
two triators walking around like thar AMERICAN PATRIOTS
the misgendered leui transitioning to lobotomy
new gender terms: dumas, medulla-less, and dum dum
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
c960aa No.12311491
Without a constant supply of adrenochrome, the replicas will enter a state of raging madness
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
5a98bb No.12311492
Anthony Quinn Warner
Death: Suicide
Suicide Squad
Lead: Harley Quinn
Warner Bros film
Producer: Steve Mnuchin
Seems legit.
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
ba7d7e No.12311493
>>12311481
…Eaten whole. Skull, bones, and all.
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
95d7d9 No.12311494
>>12311215
The futility of spending sarcasm illustrating the irony of their hypocrisy is exhausting as They are impervious to logic and immune to shame.
Like, from another planet or something. I actually don’t think there has been a fictional monster in all of film nor literature as horrifically terrifying as These so-called “people”.
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
dcb9e0 No.12311495
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
07d1f1 No.12311496
>>12311395
Feinstein twice
put Justice in front of Beyer
1 L in Lin
which Paul? first name for clarity
Halper is in two columns
keep it up
should be inNotablesso it can grow if you are not around
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
d72ab3 No.12311497
>>12311379
>Forest Scott Proctor
<Thrive
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
98ab4c No.12311498
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
870559 No.12311499
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
3582f6 No.12311500
>>12311350
You're gonna get shit on here by the rest of the anons. But Im right with you. Hang in there. I'm trying to as well!
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
b157a2 No.12311501
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
49fc32 No.12311502
>>12311411
Wonder what ol' Nunes is doing right now? You know he isn't just tucked away somewhere sitting on his hands. But he sure has been quiet through all this - so far
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
8169a2 No.12311503
>>12310953
It would seem to be the edge of complete disaster from which one cannot recover.
Folks won't take anything seriously until their toes are dangling over the edge and the wind starts picking up.
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
edaf99 No.12311504
>>12311452
These guys know what 11780 means…PANIC
>>12311469
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
bb57a4 No.12311505
>>12311019
Can't even make it up.
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
7e8926 No.12311506
>>12311480
Uh, its the FBI…
The FBI is completely corrupt and cannot be trusted. At this point they are criminals and traitors themselves…
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
dcb9e0 No.12311507
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
399f8e No.12311508
Hey Q. When will we see JUSTICE?
Asking for anons all over the WORLD.
We need a WIN sir.
o7
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
98ab4c No.12311509
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
a1b27b No.12311511
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
d5b32d No.12311512
>>12311464
RonG! YuDaHo, HornPops, Bombino,LLWoOTan, George, Phil, K9-nights, and the B-Rest of the [F]amm, bon appetito!
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
80e39c No.12311513
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
299b63 No.12311514
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
4e68dd No.12311515
Ruby 'obvious fraud' Freeman: "Special thanks to Stacy Abrams, Keisha Lance Bottoms, and Raphael Warnock."
2020 - year of Zionist-Masonic Psy-ops via Zio-masonic MSM. Luciferian Freemasonry IS Jewish. 'Ordo Ab Chao' via 33
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
167838 No.12311516
Sauce:
https://amgreatness.com/2021/01/03/defenders-of-civilization/
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
393213 No.12311517
>>12311479
(((they))) should take (((their))) time, it's not like he's dying in solitary or anything.
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
c960aa No.12311518
>>12311508
Have you met yourself yet?
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
a1b27b No.12311519
>>12311498
Attacks are proof it's over the target.
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
257d62 No.12311520
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
8169a2 No.12311521
>>12310959
And all urinating on the side of the road.
kek
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
022f3c No.12311522
>>12311429
This, unless POTUS drops some very large bombs during his rally today. Loeffler and Perdue are on track to lose their bids for the Senate.
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
b57b27 No.12311523
>>12311506
Just watch what happens.
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
2c08a3 No.12311524
>>12311389
Churchill once said that "…most men, when they stumble over the truth, pick themselves up and hurry off as if nothing happened"! Today, you are that man! You care not for the truth because The Truth threatens your constructed narrative…or, your idol! So be it! Free will!
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
dcb9e0 No.12311525
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
193173 No.12311526
>>12311204
all variations of
11,780 Q
'find 11,780 votes'
11780
1 1 7 8 0
11 780 votes
and all other variations should be looked at
could be a lead from POTUS?
Such a specific number and so much on the internet that is fishy in relation
11,780 Q
is where i began
the tecnical and computer stuff may be the purpose ?????
sure is weird all the things with bits and pieces of what we all have been digging on over the years
is 11,780 some thing the cabal/DS use to communicate COMMS?
>>12311211
>>12311221
>>12311233
>>12311236
>>12311247
>>12311249
>>12311254
>>12311261
>>12311268
>>12311277
>>12311283
>>12311293
>>12311313
>>12311355
>>12311368
>>12311376
>>12311390
>>12311406
>>12311422
>>12311432
>>12311438
>>12311442
>>12311469
>>12311470
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
99d200 No.12311527
>>12311349
Pssssst….
The McNigg is Back!!!
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
870559 No.12311528
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
1e91c9 No.12311529
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
393213 No.12311530
>>12311483
this is fucking sad.
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
c78e02 No.12311531
>>12311242
Still sad Henry Cavill doesn't want to fuck you, hunh?
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
4c76f7 No.12311532
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
a29ff6 No.12311533
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
d7aecf No.12311534
>>12311522
Thanks to that fucking cunt Mitch.
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
ba7d7e No.12311536
>>12311469
so the voting stuff isn't even hosted on the local machines?
and xenapp sux.
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
631631 No.12311537
>>12311508
Since the MSM is untrustworthy and the politicians are corrupt how will you know when 'we' get a win?
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
6e196c No.12311538
>>12311081
4 dead in Ohio. (Kent St)
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
b157a2 No.12311539
Hanks records the evidence of his kills.
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
8d25df No.12311540
Notables Are Not Endorsements
FINAL
#15715
>>12310914 Bobby Piton insinuating a fake MSM hit piece coming out on him
>>12310905, >>12310924 John Cardillo is unhinged because of Lin Wood
>>12310973 It’s a Planned Panic-demic.`
>>12311007, >>12311010 Shadow strike.
>>12311080 Cheap hair lice drug may cut risk of COVID-19 death by 80 percent: study
>>12311089 How the fake news industry manufactures hoaxes
>>12311096, >>12311139 The 1973 Home Rule Act
>>12311098, >>12311411 Congress Approves Rules Regulating Jan. 6 Electoral Vote Count
>>12311160 Mayor BOWSER has no authority over DC NG. That power belongs to President Trump only due to DC's unique status.
>>12311215 Video Of Dems Objecting to Electoral College Votes
>>12311229, >>12311284 Anon advice DC Travel
>>12311295 Georgia secretary of state's office to hold press conference Monday at 3 P.M.
>>12311378 Project Veritas: Warnock Staff Admits Candidate’s Bias Against Police
>>12311379, >>12311410 Isaac Kappy revisited
>>12311423 Make yourself heard at DOJ.
>>12311425 Netanyahu claims Iran's uranium enrichment to 20 percent is bid to develop nukes
>>12311452 Two House Democrats ask FBI Director to open "immediate criminal investigation" into Trump
>>12311457 POTUS schedule
>>12311483 Christine Assange #FreeAssangeNOW
>>12311395 Anon list: good guys, bad guys
>>12310921, >>12311021 pf
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
2234b7 No.12311541
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
01634b No.12311542
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
167838 No.12311543
If these assholes don't think we are going to liberate our children from the rule of these sociopaths, boy oh boy are they in for a surprise.
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
7f1802 No.12311544
FUCK!
DOW IS DOWN 700 POINTS!
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
4dce7a No.12311545
>>12311349
Epaulettes to make her feel empowered or something?
She looks like she will be one of 'Nancy's Noisy Ones' in the house.
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
022f3c No.12311546
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
8169a2 No.12311547
>>12310966
Sounds about right….
winds of doctrines and all.
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
b157a2 No.12311548
>>12311533
the girl has a little red bracelet
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
f08cb6 No.12311550
>>12311404
Lin wrote about that last week.
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
beff4d No.12311551
>>12311397
look at that title: ON MOTION TO TABLE THE MOTION TO POSTPONE TO A CERTAIN DAY
Fucking Orwellian doublespeak bullshit. Modern law is itself a crime and anyone who manipulates it like this is a fucking crook.
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
07d1f1 No.12311553
>>12311411
>The certificates and papers will be opened, presented, and acted upon in alphabetical order, starting with Alabama.
>
>This is when dozens of Republicans—50 representatives and 12 senators, according to an Epoch Times tally—are planning to object to some certificates, alleging election irregularities including voter fraud and failure to follow state election laws.
so objections after all states have been tallied?
one 2 hour session, or 50 2 hour sessions?
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
50fd09 No.12311554
>>12311385
muh costume is gay
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
70af41 No.12311555
>>12311492
There's a video about how Steve Mnuchin ties in (produced many movies).
DOn't forget anthony quinn
amazing polly did a vid showing his various roles and unique life and connections. He seems to be a CIA operative and roles played are like color revolutionists. Also did a movie called the Christmas eve bombing with a similar plot (but robbing a bank)…or bank of servers?
the title was changed though when released.
Then there's Time Warner
not the first time we've seen these sort of names.
Remember Adam Ward from WDBJ fake shooting and all the batman symbolism surrounnding it?
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
022f3c No.12311556
>>12311544
That is how to tell we are winning.
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
a1b27b No.12311558
>>12311544
Likely pharma companies now that price transparency has decreased their market value.
just a guess
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
dcb9e0 No.12311559
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
9cb40c No.12311561
>>12311487
Yep. Q has been great, and shown this anon just how bad it really is, out there. The absolutely insane amount of shit really is mind blowing, but none of it surprised me in the least. Shocking? Sure. Surprising, though? Maybe all that "soft disclosure" I've been exposed to in music/movies/tv just makes it all so much more believable.
>>12311517
He's not dying. He's in the safest place he could possibly be in. Anons should know this already.
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
4dce7a No.12311562
>>12311544
You're still short SWI, right?
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
b157a2 No.12311563
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
9c9792 No.12311567
>>12311430
shit jewish meme
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
a867eb No.12311568
>>12311350
yea we all go back and forth with panic and then hope, we have 2 days to see what Trump has up his sleeve. I think we can wait at least until then kek
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
5a98bb No.12311570
>>12311452
>ask FBI Director to open "immediate criminal investigation" into Trump
Finally something the FBI is competent at!
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
f08cb6 No.12311571
>>12311349
Good lord! These demon people are horrifying!
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
6870c8 No.12311573
>>12311081
Not Kent state
The veterans DC March
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
000000 No.12311574
>>12310994
How about release one convincing sample as proof - that would wake up the world overnight.
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
99d200 No.12311575
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
c67db6 No.12311576
>>12311544
Maybe we'll have a flash crash, that would be pretty entertaining.
Or better yet BTC has a massive dump and all the cryptofags lose their asses.
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
6666a1 No.12311577
Q drop 4685
09/12/2020
"Only at the precipice will people find the will [strength] to change and break the system of control [be free]."
Q Team told us that POTUS will bring this Republic to the precipice of destruction before it can be saved… don't expect anything to happen on January 6th.
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
ea3c45 No.12311578
I know, I know…trust the plan… but have to admit I'm sick to my stomach thinking Biden will be sworn in.
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
4a8786 No.12311579
>>12311499
i recently spotted a new sacrifice temple at the kremlin in the movie sum of all fears. its at 26:00 on netflix.
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
80e39c No.12311580
>>12311395
Adm Rogers works with Unit 8200
Ex-NSA employees criticize Mike Rogers' role with Israeli venture firm
https://www.cyberscoop.com/mike-rogers-team8-nsa-board-criticism-unit-8200/
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
4470a2 No.12311581
>>12311452
Kekekeke
Trying to Impeach a sitting President that is, according to them, going to be out of office in 16 days.
That doesn't smell like them winning, it smells of them being sore losers.
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
a29ff6 No.12311584
>>12311574
nope. brings everyone down. you SAVE these children, you do not exploit them. fucking SHITFORBRAINS.
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
ba7d7e No.12311585
YouTube embed. Click thumbnail to play. >>12311544
a FRN inferno!!!
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
a867eb No.12311587
>>12311568
If Trump does not have something massive to reveal on Wednesday then we can start to panic I think.
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
ef5c37 No.12311589
'Disgusting': Perdue hammers Georgia secretary of state for recording Trump call
https://www.politico.com/news/2021/01/04/perdue-hammers-ga-sec-state-recording-trump-call-454496
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
aaa771 No.12311590
>>12310921
Oak Ridge National Labs
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
748849 No.12311591
>>12311544
Gentlemen, this will be a week to remember.
Buckle up, it's only going to get worse.
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
4dce7a No.12311592
>>12311558
>Likely pharma companies now that price transparency has decreased their market value.
>>just a guess
Bad guess, tech is experiencing the biggest percentages in losses
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
332f1b No.12311593
>>12311576
>Or better yet BTC has a massive dump and all the cryptofags lose their asses.
A quantum computer would break blockchain easily that’s why I don’t mess with crypto. Too much of a short shelf life.
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
07d1f1 No.12311594
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
167838 No.12311595
>>12311374
https://en.wikipedia.org/wiki/Lizard_Squad
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
a1b27b No.12311596
>>12311567
Shit muhjoo reply/deflection.
Would you prefer another dictator defunding police so as to make room for federal terror police forces? Stalin, Mao, Mussolini?
Take your pick division faggot, it's all the same to normal healthy freedom loving people.
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
023118 No.12311597
>>12311580
Gargantuan if verified.
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
b157a2 No.12311598
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
085701 No.12311599
>>12309477
>>12310896
Also [E] is incorrect. To think Roberts will sacrifice his 2 adopted children is ludicrous. If one of them were to die, it would be too obvious. The question is what did Robert's do to buy children through Epstien. Also, still no in stone sauce Epstien is still alive.
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
a29ff6 No.12311600
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
8bd541 No.12311601
Trump Ga. Transcript Shows Case for Vote Fraud, President Acted Properly (Call Transcript)
The Washington Post on Sunday released audio of a Saturday phone call between President Donald Trump and Georgia Secretary of State Brad Raffensperger in which the two can be heard discussing election results. The Post initially released snippets of the hour-long call in which Trump can be heard discussing election results with Raffensperger and his lawyer Ryan Germany. Also joining the call was White House chief of staff Mark Meadows and Trump campaign lawyer Cleta Mitchell. Trump lays out numerous examples of double voting, dead people voting, and other ballot irregularities and anomalies. Raffensperger and Germany counter Trump's assertions largely with simple claims that the matters Trump raised have been investigated. Trump insists he won Georgia's presidential election on Nov. 3 and claims widespread fraud deprived him of that victory. The Washington Post claimed that in his talk with Raffensperger, Trump "repeatedly urged him to alter the outcome of the presidential vote in the state." This claim is false. The transcript of the call shows Trump demanding an honest accounting of the ballots, which he says would give him more than 11,000 votes. Several key excerpts of the conversation follow.
https://www.newsmax.com/politics/trump-georgia-raffensperger/2021/01/03/id/1004057/
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
65da4c No.12311602
>>12311555
>Steve Mnuchin
Interesting list of credits
https://m.imdb.com/name/nm6518391/filmotype/producer?ref_=m_nmfm_1
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
4a7074 No.12311603
>>12311452
>JUST IN: Two House Democrats ask FBI Director to open "immediate criminal investigation" into Trump
Didn't we already go thru this like 4 years ago?
Can someone teach these fuckers how to have an original thought?
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
4c76f7 No.12311604
>>12311575
"These people are stupid" aged well.
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
022f3c No.12311605
>>12311491
After three years, we have exactly zero evidence that adrenochrome has anything to do with all of this.
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
ba7d7e No.12311606
>>12311593
sif the ccp hasn't been manipulating crypto…
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
4dce7a No.12311607
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
70af41 No.12311608
>>12311555
pic related…there was a photo of her dressed in batman attire on her old FB. Can't find it….same for the other guy Ward and the fake wound makeup on both. So obvious an op
>>nice find
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
6381ea No.12311609
LPence sounds like a democrat! Wtf?
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
d7aecf No.12311611
>>12311580
>Robert Lee
This is the guy from the article who was mad at Rogers. Look at the filth that this sick fucker puts out. Leads me to believe that Mike Rogers's work was for a good cause.
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
477ea4 No.12311612
>>12311562
I don’t short
Betting to lose seems like bad karma
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
a1b27b No.12311613
>>12311592
If true I think that's notable.
Post sauce, anon, and ping baker.
Tech companies getting hammered is relevant….insiders drive market prices so maybe something big is happening…
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
b157a2 No.12311614
>>12311587
Let's do it today- 2 days ahead of schedule
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
80e39c No.12311615
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
022f3c No.12311617
>>12311601
He acted properly on the Ukraine call too. They still impeached him. They will do it again.
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
327bc8 No.12311618
https://twitter.com/LLinWood/status/1346151157878697984
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
6381ea No.12311619
https://www.facebook.com/ABCNews/videos/831815804050197/
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
b0799f No.12311620
>>12311454
These videos are the ones that the left and media have been yelling about being "deep fakes". These are what they were scared of being released. They were warned if they didn't give in these would be released. Tit for tat game of chicken continues.
>Sometimes you can't TELL the public the truth.
>YOU MUST SHOW THEM.
>ONLY THEN WILL PEOPLE FIND THE WILL >TO CHANGE.
>Crimes against children unite all humanity [cross party lines]?
>Difficult truths.
Stage set.
Release before the 5th? That would be interesting affect on Georgia election.
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
1ed846 No.12311621
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
56c68e No.12311622
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
4e68dd No.12311623
We know as much. It's time for the sheeple to know as well.
https://laitonlehti.net/2019/09/10/did-epstein-and-maxwells-bug-the-internet/
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
870559 No.12311624
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
d7aecf No.12311625
>>12311601
Like I expected, another perfect phone call.
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
3bb08e No.12311627
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
a867eb No.12311628
>>12311618
Lin Wood covering his ass for defamation
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
022f3c No.12311629
>>12311618
His credibility is going up in smoke today.
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
399f8e No.12311630
>>12311618
well he hit the brakes pretty fast now didn't he?
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
a3f4a4 No.12311631
>>12311415
>>12311415
Dag nab it, I bin Posting dat
fer de last week now, and
Yoor de furs wun nize enuf
to poyn dat out twoo me !
Tenk Yoo ! !
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
6381ea No.12311632
>>12311603
Probably trying to find out who Q is. Pray Anons.
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
a29ff6 No.12311633
>>12311614
everyone should gather in DC TOMORROW instead.
the element of surprise
\plus it would be funny
and costumes!
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
b02bb8 No.12311634
>>12311519
>Attacks are proof it's over the target.
your interpretation is not a fact.
nice try
faggot
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
47cf17 No.12311636
>>12311622
The 'only' nazi's. FTFY
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
95e38e No.12311638
>>12311618
More of this …
Of course…
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
b157a2 No.12311640
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
f7df61 No.12311642
>>12311108
Didn't POTUS tweet the word Guardians today, the 4th? Big panic on the 5th? FISA bringing down the house on the 6th?
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
a29ff6 No.12311643
>>12311631
it's like when your zipper is open and no one says anything to you
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
9eaf72 No.12311644
>>12311587
>then we can start to panic
I'll reevaluate my position relative to Q beginning the day after DJT leaves office. No sooner.
Precipice.
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
ba7d7e No.12311645
>>12311628, >>12311629, >>12311630
Bets are on that lin got the attention of shills with experience, kek.
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
70af41 No.12311646
YouTube embed. Click thumbnail to play. >>12311602
Oh wow. Inherent vice is one of my favorite movies. Def Q related topics…drug/human trafficking, MKUltra, Cults, Hollywood, BLM(black panthers),psyops, FBI, etc.
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
f56d94 No.12311647
>>12311618
That name has been on QR since forever.
https://qresear.ch/?q=holmseth
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
f08cb6 No.12311648
>>12311452
We could pay the national debt just with Pay per View on Ted Lieu's Treason Tribunal and execution!
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
a97eec No.12311649
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
3bb08e No.12311651
>>12311628
Lin Wood is not the "cover your ass" type.
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
ff2432 No.12311652
>>12311544
Gold and Silver are predictably up
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
4dce7a No.12311654
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
b57b27 No.12311656
>>12311618
I've been saying for a couple years now that some of these high profile people need advisors like us - people who scour the internet and research night and day. A lot of these "traps" they fall into could be easily avoided with the right person on their team.
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
56c68e No.12311657
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
e1d914 No.12311658
>>12311580
good guy or bad guy?
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
8d25df No.12311660
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
b0799f No.12311661
>>12311454
Interesting I don't even get a comment from the shill teams… don't want to touch it?
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.
841da3 No.12311662
>>12311620
Air the blackmail video on the jumbotron at the rally
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.