[ / / / / / / / / / / / / / ] [ dir / random / islam / jewess / komica / lit / loomis / pen / wactor / x ]

/qresearch/ - Q Research

Research and discussion about Q's crumbs
Name
Email
Subject
REC
STOP
Comment *
File
Password (Randomized for file and post deletion; you may also set your own.)
Archive
* = required field[▶ Show post options & limits]
Confused? See the FAQ.
Embed
(replaces files and can be used instead)
Options

Allowed file types:jpg, jpeg, gif, png, webp, webm, mp4, mov, pdf
Max filesize is 16 MB.
Max image dimensions are 15000 x 15000.
You may upload 5 per post.


Welcome Page | Index | Archive | Q Posts | Notables | Q Proofs
Q's Board: /projectdcomms/ | Legacy Boards: /CBTS/ /TheStorm/ /GreatAwakening/ | Politics News & Debate: /pnd/

File: 3a4e4d2ff47e574⋯.jpg (86.64 KB, 1752x942, 292:157, 3a4e4d2ff47e574bb8a285448b….jpg)

3580c7  No.16247170[Last 50 Posts]

Welcome to Q Research General

We are researchers who deal in open-source information, reasoned argument, and dank memes. We do battle in the sphere of ideas and ideas only. We neither need nor condone the use of force in our work here.

"We hold these truths to be self-evident: that all men are created equal; that they are endowed by their Creator with certain unalienable rights; that among these are life, liberty, and the pursuit of happiness."

VINCIT OMNIA VERITAS | SEMPER FIDELIS | WWG1WGA | QRESEARCH

Q's Private Board

>>>/projectdcomms/ & Q's Trip-code: Q !!Hs1Jq13jV6

100+ Q Proof Graphics

QProofs.com ————————————–——– Website dedicated to Q Proofs

>>15476532 ————————————–——– Thread

Q Graphics

>>15412505, >>15412491 Q Graphics

Q Happenings Calendar

Submit an Event ————————————–——– https://teamup.com/ks8x4ixptej432xt2a

Find Q drops here

Main QAnon.pub - qresear.ch/q-posts - QAlerts.pub - operationQ.pub - QPosts.online - qanon.news/Q - 8kun.top/qresearch/qposts.html

Backups qntmpkts.keybase.pub - QAlerts.app - QAlerts.net - douknowq.com/134295/Q-Anon-Pub.htm - we-go-all.net/q.html -

QPosts Archives

* QMap & Mirrors PDF: SCRIBD: https://www.scribd.com/document/419874308/Q-Anon-The-Storm-X-VII?secret_password=55SQ1tCYhuNR8ESzm50u

* QPosts Archive, Players in the Game/ Analytics on Q posts & More: qmap.pub

* QPosts Archive, Searchable, interactive with user-explanations: qanon.pub qanon.app

* QPosts Archive + RSS, Searchable, Analytics, Offsite Bread Archive: qanon.news

* Spreadsheet QPosts Q&A and all images backup: https://docs.google.com/spreadsheets/d/1Efm2AcuMJ7whuuB6T7ouOIwrE_9S-1vDJLAXIVPZU2g

* Q Raw Text Dumps: q-clock.com/q_raw.txt

* Spreadsheet Timestamps/Deltas: docs.google.com/spreadsheets/d/1OqTR0hPipmL9NE4u_JAzBiWXov3YYOIZIw6nPe3t4wo/

* Memo & OIG Report Links: 8kun.top/qresearch/res/426641.html#427188

* Original, full-size images Q has posted: https://postimg.cc/gallery/29wdmgyze/

Q's Latest Posts

Tuesday 12.08.2020

>>11953143 ————————————–——– We're Not Gonna Take It (CAP: >>11953295)

Q Research

Welcome

>>15406810, >>16085354 New here? Welcome | >>15406442 Board Info, Offsite Bunkers, Optics | >>15406807 Suggested Follow

>>15406812 Other Research Threads | >>15557963 International Research Threads 2-5-2022

>>15406815 Resignations & Sealed Indictments | >>15406816 Archives

Tools and Services

>>15406428 Dough Resource Thread

>>15406802 Standard Infowar Procedures | >>15406811 Information Tools & Services

>>15406808 !!!! LEARN DIGITAL WARFARE !!!!

>>16093637 Q Encyclopedia by ArchiveAnon | >>16092925 Q Video Archive by ArchiveAnon

Join Us

>>15600441 =!!! LEARN TO BAKE !!!= | >>15406818 Iwo Jima YouTube Link

>>15406820 Meme Requests

____________________________
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

3580c7  No.16247173

GLOBALS

>>15487554 Use /tech/ for ban lifts & bug reports

>>15443568 HOW TO BAKE Thread; >>16087759 Newfag Q&A Thread

>>15620842 Banner guidelines

>>16199152 HB laptop dig – REPORT CP via GLOBAL; No kiddie pics

>>15960983 Inserting baker changes into notable buns

>>16050716 Coordinating baking & notetaking; plz tag the dough

>>16244833, >>16244813 2000 Mules - Full Documentary

NOTABLES ARE NOT ENDORSEMENTS

#20551

>>16246461 RussiaToday - Niels Harrit Interview (RT)

>>16246490 6 Airmen Caught with Thousands of Rounds of Stolen Ammo, Federal Indictment Alleges

>>16246495 Barr on SCOTUS home protests: Fed crime to protest @judges' homes

>>16246513 TRENDING MULES Dinesh D’Souza Podcast Ep326

>>16246524, >>16246532 Are encryption apps sinking open government in Harris County?

>>16246537 In Ukraine, gas shortages further complicate daily life

>>16246560, >>16246669 Russian father facing murder charges for killing paedophile for raped 8yrold daughter gets crowdfunded by neighbors

>>16246565, >>16246572 Chuck Dolan DIGG

>>16246580 Ken Roberts suggest that Musk by censor-happy YOUTUBE next

>>16246591 Lightfoot issues a "call to arms" in reaction to SCOTUS

>>16246528, >>16246592 Bongino: Explosive evidence surfaces about the 2020 election (2000 Mules)

>>16246597 Gen Flynn @TS: OP against Flynn was ordered by Obama and Biden on Jan 5, 2017

Baker Change

>>16246648 Prison officer who fled with prisoner on retirement shoots herself after being caught

>>16246656 'Sounded like thunder' Car crashes into the front of Boris Johnson's £1.2m house

>>16246680 Rebranding Nazism

>>16246679 The Wartime Presidency Part VII

>>16246719 Safe and Effective Abortions Out of 27 women that were accidentally pregnant during the vacc program. Outcome: 23 spontaneous abortions. 2 premature with neonatal death. Pfizer doc 5.3.6 page 12

>>16246924 The House could vote as soon as tonight on a $40 billion package of military and humanitarian aid for Ukraine

>>16246991 Planefag spots private jet of James Packer (Crown Resorts Australia) over the US and heading West.

>>16247028 Jack Posobeic Fair warning: If you run for office as a Republican we are going to demand you do your jobs. This is the New Right now. No more Trey Gowdy stuff.

>>16247066 US House subcommittee will hold a public hearing on #UFOs, now called unidentified aerial vehicles, next week for the first time in more than half a century

>>16247122 Another One: Kelly Ripa has tested positive for COVID-19 and is following protocols

>>16247167 #20551

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

3580c7  No.16247174

#20550

>>16245651 QClock May 9, 2022 SCOTUS Security, Queen

>>16245717 Ngo still on twat

>>16245727 Biden DOD demands Mike Flynn fork over speech fee even though he helped DIA spy on Russians

>>16245732 Missouri Senate Passes Election Integrity Bill

>>16245757 Chicago Mayor Lori Lightfoot Issues a “Call to Arms” in Reaction to Supreme Court

>>16245764, >>16245942 Biden revives World War II arms act for Ukraine

>>16245776 Northern Territory Chief Minister Michael Gunner resigns

>>16245808 SUSSMANN FINAL Pre-Trial RULINGS on JOFFE Emails, FUSIONGPS and FBI

>>16245810 Australian share market suffers nearly $40 billion loss as 'war, inflation, rate hikes' hit global markets

>>16245824 Child sexual abuse survivor Adam Kneale sues AFL club Western Bulldogs for damages

>>16245914 Did anybody download the voter roll from Wisconsin, before [they] deleted it?

>>16245921 Bongbong Marcos poised to win Philippines erection in landslide

>>16245933 Republican running against Omar

>>16245941 Kyle Rittenhouse has a Steam Game Out, Help get it to the top of Steam Ratings

>>16245974 EU to go into debt for Ukraine ???

>>16245991 Moar on Musk didn't kill himself

>>16246023 9 May, 2022 21:04White House comments on Supreme Court protests

>>16246140 ICYMI: California desalination plant hits regulatory hurdle/watch the water

>>16246159 Air Force is on Truth Social and they are following just two accounts/TS and 45

>>16246174, >>16246189 >>16246192 CFR: Dismantling Disinformation

baker change

>>16246335 Podesta/Ruddy/Vatican Connection

>>16246372 #20550

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

3580c7  No.16247178

#20549

>>16244793, >>16244799, >>16244816, >>16245079, >>16245083 Otero County Special Meeting: Discuss the 2020 Election Audit Findings

>>16244822 Benequista: clown since hs in Tucson, Az…Wife is Sarah Coll-Black from World Bank, her family is Conrad Black

>>16244833, >>16244813 2000 Mules - Full Documentary

>>16244837 Human Trafficking: Over 831 victims rescued, 31 prosecutions, 13 convictions in 2021

>>16244869 @Jim_Jordan Joe Biden's FBI:.....

>>16244900 PEDO BUN 9 May 22

>>16244973, >>16244998 US-Israeli cyber firm uncovers ‘massive’ Chinese-backed industrial espionage ring???

>>16245081, >>16245085 swamp stuff tomorrow morning

>>16245166, >>16245279 Qclock The Bridge JA returning to the stage, tomorrow is 5:5

>>16245175 Pope Francis is postponing his June trip to Lebanon

>>16245189 @TheDemocrats Republicans have a plan to sunset Social Security and Medicare after 5 years if they win power

>>16245210 The National Endowment for Democracy (NED) diggz

>>16245211 Ron Johnson opens probe into CDC tracking Americans through phone data

>>16245234 General Electric Co, sold Baker Hughes Co.:$2.4B-May 6

>>16245268 Tesla Halts Output at Shanghai Plant on Supply Issues

>>16245362, >>16245380 China Tech Stocks Tumble Near 7% as Traders Return From Holiday

>>16245479 THE PLAN: THE WHO HAS PLANNED FOR 10 YEARS OF INFECTIOUS DISEASES, FROM 2020 TO 2030

>>16245492 How about finishing these digs.

>>16245522 #20549

Previously Collected

>>16245522 #20549, >>16246372 #20550, >>16247167 #20551

>>16243182 #20546, >>16243930 #20547, >>16244763 #20548

>>16240857 #20543, >>16241623 #20544, >>16242436 #20545

>>16238546 #20540, >>16239337 #20541, >>16240121 #20542

General Notable Pins: https://ghostbin.com/14ehq

TripCode feed: https://8kun.top/qresearch/tripcode.xml

Aggregators: https://qnotables.com | https://anontimes.com/

>>16207042 Notables #13: Born For This!

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

3580c7  No.16247179

Dough

https://controlc.com/29c58d27

Baker requests Handoff

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

3768df  No.16247186

File: 88d5b18a41c67c9⋯.png (401.71 KB, 500x697, 500:697, ClipboardImage.png)

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

64f34d  No.16247187

File: 4cf969869060dab⋯.png (87.17 KB, 816x783, 272:261, Screenshot_2022_05_10_at_1….png)

Ministry of Defence of the Russian Federation

Ukraine Ops Report

10.05.2022 (11:30)

Briefing by Russian Defence Ministry

Units of the People's Militia of the Lugansk People's Republic, supported by the Armed Forces of the Russian Federation, have completed mopping-up of Popasnaya from nationalists and broken through the deeply echeloned enemy defence and reached the administrative border of the Lugansk People's Republic.

The attacks have resulted in the elimination over 120 nationalists and 13 armoured and 12 vehicles of various purposes.

Operational-tactical and army aviation of the Russian Aerospace Force have hit 16 areas of AFU manpower and military equipment concentration.

Missile troops and artillery units have hit 33 command posts, 407 areas of manpower and military equipment concentration, as well as 5 ammunition and fuel depots near Nikolaev and Mirnyi, Nikolaev Region.

The attacks have resulted in the elimination of more than 380 nationalists and up to 53 armoured and motor vehicles.

On the evening of May 9, 1 Su-25 aircraft of the Ukrainian Air Force have been shot down during an aerial battle near Novaya Dmitrovka, Kharkov Region.

Russian air defence means overnight have shot down 3 Ukrainian unmanned aerial vehicles near Mospino, Yunokommunarsk of the Donetsk People's Republic and Odessa city.

1 Ukrainian Tochka-U missile and 1 Smerch multiple-launch rocket have been intercepted over Khartsyzsk in the Donetsk People's Republic. Two more Smerch multiple-launch rockets have been shot down near Malaya Kamyshevakha and Izyum, Kharkov Region.

In total, 163 Ukrainian aircraft and 124 helicopters, 793 unmanned aerial vehicles, 300 anti-aircraft missile systems, 2,979 tanks and other armored combat vehicles, 351 multiple launch rocket systems, 1,440 field artillery and mortars, as well as 2,789 units of special military vehicles were destroyed during the operation.

https://eng.mil.ru/en/news_page/country/more.htm?id=12420770@egNews

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

64f34d  No.16247205

File: 97ae517ad95d0f6⋯.png (98.33 KB, 797x1034, 797:1034, Screenshot_2022_05_10_at_1….png)

Ministry of Defence of the Russian Federation

Ukraine Ops Report

09.05.2022 (19:15)

Briefing by Russian Defence Ministry

The Armed Forces of the Russian Federation continue the special military operation in Ukraine.

High-precision air-based missiles of the Russian Aerospace Forces have hit 11 areas of manpower and military equipment concentration, 4 company strongpoints, 8 ammunition depots of the Ukrainian Troops near Konstantinovka, Antonovka, Elizavetovka, Dolina and Lisichansk as well as 2 air target detection radar stations near Kramatorsk and Krestischa.

According to the updated information, 6 Mi-8 and Mi-24 helicopters have been destroyed during the night near Artsiz in Odessa Region near the Chervonoglinskoe military airfield by Onyks high-precision missiles from the Bastion coastal missile system.

Operational-tactical and army aviation of the Russian Aerospace Force have hit 2 strong points and 5 areas of concentration of AFU manpower and military equipment.

Missile troops and artillery units have hit 318 areas of manpower and military equipment concentration.

The attacks have resulted in the elimination of more than 400 nationalists and up to 48 armoured and motor vehicles.

During the day, Russian air defence means have shot down 1 MiG-29 aircraft of the Ukrainian Air Force over Severodonetsk city.

In addition, 3 Ukrainian unmanned aerial vehicle have been over Novozvanovka, Khartsyzsk and Izyum.

1 Ukrainian Tochka-U rocket was intercepted near Ivanovka, Kharkov Region, and 2 Smerch multiple-launch rockets were intercepted near Bolshaya Kamyshevakha and Izyum.

In total, 162 Ukrainian aircraft and 124 helicopters, 790 unmanned aerial vehicles, 299 anti-aircraft missile systems, 2,967 tanks and other armored combat vehicles, 347 multiple launch rocket systems, 1,432 field artillery and mortars, as well as 2,778 units of special military vehicles were destroyed during the operation.

On 7 May, on direct orders from Zelensky, the Ukrainian General Staff, with the direct involvement of advisers from the USA and Britain, planned a major provocation to seize Zmeiny Island.

Over the past two days, the Kiev regime has made several desperate attempts to land air and sea assaults on Zmeiny Island, which is important for controlling the northwestern part of the Black Sea.

The Ukrainian provocation was thwarted as a result of the competent actions of a Russian Armed Forces unit on the island. The enemy suffered heavy losses.

4 Ukrainian airplanes, including 3 Su-24 and 1 Su-27, 3 Mi-8 helicopters with paratroopers on board, and 1 Mi-24 helicopter have been shot down in the air while repelling the attacks near Zmeiny Island.

Within two days, 29 Ukrainian UAVs have been shot down in the air, including 8 Bayraktar TB-2 strike UAVs. Meanwhile, 4 Bayraktar drones have been shot down this afternoon.

Also, 3 armoured Ukrainian amphibious assault boats carrying Ukrainian naval personnel were destroyed during an attempted landing on the night of May 8.

As a result of Zelensky's thoughtless provocation, more than 50 Ukrainian saboteurs have been killed at sea and on the coast during the landing and attempts to consolidate on the island.

24 bodies of dead Ukrainian servicemen were left on the shore of Zmeiny Island.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

64f34d  No.16247207

>>16247205

Linky

https://eng.mil.ru/en/news_page/country/more.htm?id=12420647@egNews

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

ede002  No.16247211

Jesus/Christianity is the GREATEST DECEPTION OF ALL TIME.

Watch this video: It unequivocally proves that Jews see Jesus as their hidden Messiah, and the manifestation of Mosiach Ben Joseph, AKA Leviathan/ Metatron.

(((They))) are literally telling you their entire deception plan, and you fucking Christ-cucks, are just lapping it up and sucking Q-cock.

YOU ARE SLAVES… And given your distinct slave-morality and mentality, maybe many of you deserve to be slaves… because you WANT to be slaves.

The sad fact is, the majority of you are INTELLECTUAL COWARDS.

https://odysee.com/@KnowMoreNews:1/Kabbalah-Guru-Jewish-Jesus:0

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

e24a5d  No.16247212

File: 1a89b00d7a52a1c⋯.png (137.34 KB, 1020x680, 3:2, account_upgrade.png)

>>16247179

Confirm Handoff?

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

f6284f  No.16247215

File: 43232eed7992654⋯.png (393.45 KB, 960x724, 240:181, 1652158085324.png)

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

3580c7  No.16247217

File: 0dd4f20e3c7017d⋯.jpg (59.71 KB, 600x600, 1:1, 0dd4f20e3c7017ddbc782a54d7….jpg)

>>16247212

Handoff Gratefully Confirmed

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

19144d  No.16247218

File: 1eb9f7c5ea180af⋯.jpeg (250.6 KB, 520x1008, 65:126, B8366091_5A37_48E6_9346_0….jpeg)

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

2d83e4  No.16247219

File: 36f0af7b35de1a9⋯.png (47.74 KB, 187x153, 11:9, ClipboardImage.png)

>>16247179

>Dough

The special forces of the DPR army tracked down the headquarters of one of the artillery units of the Armed Forces of Ukraine in the Donetsk direction. After waiting for their commanders to gather at headquarters, an ATGM was struck. After the surviving Ukrainians running out of the headquarters turned out to be naked, it became clear what their gunners were doing at meetings. Now the world community will accuse our side of mass killing of LGBT people.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

50658c  No.16247220

File: ef66382a17ca43f⋯.jpg (145.87 KB, 514x192, 257:96, our_wings_are_growing_2.jpg)

>>16247179

tyb

o7

our wings are growing, We are resonating.

WE are growing louder & stronger! #GODWON

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

8cb4ba  No.16247221

File: ecf588062f6df0b⋯.png (1.3 MB, 944x632, 118:79, ClipboardImage.png)

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

54c3ec  No.16247223

File: 7a0607cc548c051⋯.png (337.11 KB, 716x685, 716:685, 2f6032f8ecb9c25c8b1613759b….png)

File: 2d02b2cecbf0c59⋯.gif (937.67 KB, 500x393, 500:393, 2d02b2cecbf0c5924ce631b4cf….gif)

>>16247217

I would have loved to be the tattoo artist for that job

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

3580c7  No.16247224

>>16247223

It being Taco Tuesday I figured I'd use that one

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

e24a5d  No.16247225

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

ede002  No.16247226

File: 56be9167aa60727⋯.png (512.32 KB, 1167x690, 389:230, Screen_Shot_2022_05_10_at_….png)

File: 66dbc87b85910e3⋯.png (122 KB, 1092x337, 1092:337, Screen_Shot_2022_05_10_at_….png)

File: 5d0c2cd0f326bb5⋯.png (120.62 KB, 1067x329, 1067:329, Screen_Shot_2022_05_10_at_….png)

File: 373e3d644beb47c⋯.png (267.29 KB, 757x676, 757:676, Screen_Shot_2022_05_10_at_….png)

>>16247211

Read the book; "The Return Of The Kosher Pig"…

Learn the truth about Bar Abbas, who was released instead of Jesus (He was a PATRIOTIC hero to the people, a William Wallace, Robin Hood, type…. While Jesus was a lying, begging, loser, KIKE. Were you even aware? Of course not…

https://kosherpig.org

YOU ARE BEING JEWWED… And tricked into worshipping a Jew, AGAIN.

Adam Green, explains all this very well. So does Christopher Jon Bjerkness.

https://twitter.com/Know_More_News/status/1523867141132279808

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

8cb4ba  No.16247227

File: 73a384f2fca3dab⋯.png (771.8 KB, 771x543, 257:181, ClipboardImage.png)

File: 777dde00f1546a3⋯.png (745.3 KB, 944x372, 236:93, ClipboardImage.png)

>>16247220

yeah that too

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

ede002  No.16247228

>>16247211

>>16247226

And hey Q…. FUCK YOU, and your Jew handlers, you filthy, lying, KIKE, POS.

I knew your bitch-ass was just a Craft International, Jewish-Nigger, picking cotton for your Rabbinical overlords. Neck yourself, you worthless, fucking turd.

I don't work on this farm no moar.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

e1e7b5  No.16247229

Does anyone have the meme with the aliens being on stage next and being nervous about it?

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

345719  No.16247230

File: 681ac6bb54901f3⋯.png (880.85 KB, 890x499, 890:499, aliens3.png)

>>16247229

This one?

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

e1e7b5  No.16247231

>>16247230

Yes, thank you!

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

8fa33e  No.16247232

File: 6d97e0e2c6390de⋯.png (282.03 KB, 828x595, 828:595, ClipboardImage.png)

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

074bea  No.16247233

File: 7e342649481fb9f⋯.png (493.68 KB, 423x599, 423:599, Screenshot_2022_05_10_at_0….png)

New documentary

PANDAMNED - THE DOCUMENTARY

SELECT YOUR SUBTITLES BY CLICKING ON THE "CC" BUTTON

For the past two years, the world population has been under the spell of the coronavirus. Emergency regimes have been established, civil liberties have been dismantled, surveillance programs were being installed and an unprecedented global vaccination program has been rolled out.

Are we doing the right thing, or did we make a deal with the devil in exchange for a benefit? Through critical voices from various areas of expertise, PANDAMNED attempted for the first time to paint the whole picture and shed light on the darkness. It has become a relentless stocktaking of our time, which global organizations, governments and big tech companies would have preferred to prevent.

Documentary maker Marijn Poels takes the viewer on an enlightening journey through the emerging absurd world of the "New Normal" and how we can still prevent it.

https://www.marijnpoels.com/copy-of-pandamned-englisch

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

b0aad6  No.16247234

File: 2a20225a6eeb1df⋯.jpeg (67.89 KB, 480x464, 30:29, AZ_voter_2022.jpeg)

>>16247214

Democrats think that Water Meters are more important than Filtering or building new Primary Water sources out.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

8b539c  No.16247235

File: 80643900123ad6c⋯.jpg (62.17 KB, 639x473, 639:473, 2022_05_10_083108.jpg)

https://twitter.com/DineshDSouza/status/1523844228694093827

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

f6284f  No.16247236

File: 918e09b06305ebe⋯.jpeg (Spoiler Image, 428.12 KB, 820x533, 20:13, taco.jpeg)

>>16247224

Taco Tuesdays are amazing.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

778aae  No.16247237

File: 0ff2d44c5bac852⋯.png (86.34 KB, 263x192, 263:192, ClipboardImage.png)

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

50658c  No.16247238

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

e21051  No.16247239

Huma Abedin,

Trisha Anderson,

Manos Antonakakis,

Robert P. Ashley,

Brian Auten,

Hina R. Alvi,

Abid Awan,

Imran Awan,

Jamal Awan,

James Baker,

Nada Bakos,

Jeremy Bash,

William Barr,

Robert Bauer,

Joe Biden,

Dennis Blair,

Dana Boente,

Jennifer Boone,

Patty Brandmaier,

John Brennan,

Keith Bristow,

James B. Bruce,

David Buckley,

George Bush Jr.,

Jean L. Camp,

David Cariens,

Janice Cariens,

James Clad,

James Clapper,

Kevin Clinesmith,

Hillary Clinton,

William Clinton,

James Comey,

Patrick Conlon,

Peter Corsell,

Steven Cuevas,

David Dagon,

Igor Danchenko,

Brett Davis,

Michael Dempsey,

Joseph DiBartolomeo,

Charles H. Dolan Jr.,

Marc Elias,

Stuart Evans,

Peter Fritsch,

Tashina Gauhar,

Roger Zane George,

Glenn Gerstell,

Carl Ghattas,

Charles Ronald Llewelyn Guthrie,

Steven L. Hall,

Stefan Halper,

John Hannah,

Kent Harrington,

Gina Haspel,

Curtis Heide,

Don Hepburn,

Eric Holder,

Michael Horowitz,

John Huber,

Calvin Humphrey,

Adam Irwin,

Kathleen Kavalec,

Timothy D. Kilbourn,

Paul Kolbe,

David Laufman,

April Lorenzen "tea leaves"

Stephen Laycock,

Jacob "Jack" Lew,

Rodney Joffe,

Andy Liepman,

Loretta Lynch,

Ron Marks,

Andrew McCabe,

Mary McCord,

Denis McDonough,

Arthur McGlynn,

Jonna Hiestand Mendez,

Joseph Mifsud,

Sergei Millian,

Jonathan Moffa,

John Moseman,

Sally Moyer,

Emile Nakhleh,

Mike Neufield,

Sean Newell,

Victoria Nuland,

Barrack Obama,

Bruce Ohr,

Nellie Ohr,

Gerald A. O’Shea,

Stephanie L. O’Sullivan,

Lisa Page,

Mike Pence,

Joseph Pientka,

Larry Pfeiffer,

John Podesta,

Marc Polymeropoulos,

Mike Pompeo,

Anna Popova,

Samantha Power,

David Priess,

E.W. “Bill” Priestap,

Pam Purcilly,

Sarah Raskin,

Steve Ricchetti,

Susan Rice,

Rod Rosenstein,

Christopher M. Sanders,

Gabriel Sanz-Rexach,

Chris Savos,

Debbie Wasserman Schultz,

Jeff Sessions,

John Sipher,

Nick Shapiro,

Nathan Sheets,

Elizabeth Sherwood-Randall,

Glenn Simpson,

Petra Sipe,

Stephen Slick,

Rodney Snyder,

Steve Somma,

Cynthia Strand,

Peter Strzok,

Michael Sussman,

Adam Szubin,

James Taliento,

Greg Tarbell,

David Terry,

Russ Travers,

Greg Treverton,

John Tullius,

"Azra Turk"

David A. Vanell,

Natalia Veselnitskaya,

Alexander Vindman,

Paul Vixie,

M. Ro. Wahid,

Winston Wiley,

Jonathan Winer,

Kristin Wood,

Christopher Wray,

Sally Yates

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

54c3ec  No.16247240

File: 301c13fb9f8bbcd⋯.jpg (32.72 KB, 473x565, 473:565, 9a5a9557ffafc75953c0494125….jpg)

>>16247235

>citing a "republican" justice to convince libtards

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

2d83e4  No.16247241

File: 06ebfd8a793d4c9⋯.mp4 (1.81 MB, 480x608, 15:19, sleep.mp4)

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

347e8d  No.16247242

File: bc4682d00ed2fcf⋯.png (1.29 MB, 1209x713, 39:23, bless.png)

God bless you and keep you from harm, this day and forever.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

b0aad6  No.16247243

File: 7311ae49d6a6eb5⋯.jpeg (108.34 KB, 1280x856, 160:107, FSXrNsiWQAEpQ9O.jpeg)

Let's go dottard

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

54c3ec  No.16247244

File: 19dc73d0a89785d⋯.jpg (46.47 KB, 474x632, 3:4, 674fa3a70463bc881e30e4c3e0….jpg)

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

8fa33e  No.16247245

File: d76a4d9e6a8e1a4⋯.png (619.89 KB, 906x534, 151:89, Swordy.png)

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

50658c  No.16247246

>>16247239

nobody likes a tease. kek

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

83625a  No.16247247

Imagine the horror of having your city blown to bits, lives destroyed, hunger, despair, and then you are forced to listen to U2.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

e24a5d  No.16247248

File: 7477fabd320e13d⋯.png (52.53 KB, 800x519, 800:519, jewish_anarchy.png)

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

2630d7  No.16247249

YouTube embed. Click thumbnail to play.
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

2d83e4  No.16247250

File: ff5719def89be3e⋯.mp4 (214.24 KB, 512x256, 2:1, _timand2037_ILRUSSO1_Remem….mp4)

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

b959ee  No.16247251

File: 487359db2775776⋯.gif (9.76 MB, 480x360, 4:3, Trump_Won_Sun_Pepe.gif)

File: dff0a872679bc93⋯.jpg (84.33 KB, 1021x732, 1021:732, Pavarotti_Trump_Won.jpg)

File: 50e8746d7f380fe⋯.jpg (54.08 KB, 533x518, 533:518, Trumpnado.jpg)

Why did YouTube take down a single video of the True President Donald John Trump, which has Moar views, likes, and exposure than ALL of Fake Potato President COMBINED?

NCSWIC

>>16246580 Ken Roberts suggest that Musk by censor-happy YOUTUBE next

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

8b539c  No.16247252

1

9 May 2022

Military.com | By Drew F. Lawrence

Six airmen had 14,000 rounds of stolen ammunition, mostly from Fairchild Air Force Base in Washington, according to federal court documents filed May 3. The ammunition was discovered after at least one of the airmen allegedly made online threats advocating for the violent overthrow of the federal government.

The FBI's Seattle Division opened the investigation into the airmen last August after Staff Sgt. John I. Sanger began discussing acts of violence and advocating for the seizure of the U.S. Capitol.

Sanger and the five other airmen have been charged with conspiracy to steal government property, possession of stolen ammunition, and possession of an unregistered firearm.

Read Next: What the Military Records of the Oath Keepers' Leader Actually Say About His Service

"They defrauded our election system and are still getting away with it," Sanger wrote in December 2020 under the social media moniker "problematicpatriot," according to the FBI's affidavit. "That means this system has run it's [sic] course. People have to die."

Sanger has pleaded not guilty.

In March 2022, Sanger along with Staff Sgt. Eric Eagleton, another airman accused in the indictment met with an undercover Office of Special Investigations agent who was wearing a wire.

According to the affidavit, Eagleton told the agent that he and other members of Fairchild's 92nd Security Forces Squadron Combat Arms Training and Maintenance center regularly stole ammunition from the armory, adding that he stole up to 3,000 rounds of ammunition per day.

"Teaching these f—ing retards how to handle weapons is pointless," Eagleton allegedly told the special agent. "They literally can't remember how to clear it out, what's the point anyways, send them downrange anyways and let me steal all this ammo."

Nathaniel Richards, another airman accused in the plot, later told the agent that members of the group falsified weapons' qualifications to show that the ammunition was used in training when it was actually stolen for "personal use," according to court documents.

Some 5.56mm ammunition recovered by the Air Force OSI agent during the sting was noted as "expended" a year prior by Fairchild personnel, with some rounds discovered in Richards' residence in Nevada after he transferred to Creech Air Force Base, prosecutors allege.

"We are aware of the arrest of the Airmen stationed here at Fairchild Air Force Base," 1st Lt. Michelle H. Chang, a spokesperson for the 92nd Air Refueling Wing, told Military.com in an email. "We have been and continue to work closely with federal law enforcement authorities to provide all relevant information to assist in this ongoing investigation."

Ammunition, "consistent with the stolen ammunition," according to court records, was also discovered in the residences of Sanger, Eagleton, Shawn Robson, Austin Limacher and Jonah Pierce – the other airmen charged in the indictment. Ranks for the four other airmen were not included in court ….continue :

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

784d35  No.16247253

File: f5b3d0915e2dc51⋯.jpg (188.77 KB, 699x662, 699:662, f5b3d0915e2dc519e25fc886d2….jpg)

>>16247228

Well then genius. GTFO here. Why you here? If you can look at all around you, everything and believe it all happened by chance? A fluke? You are one myopic, ignorant, stupid motherfucker. Fuck the hell off back to facebook where you belong.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

50658c  No.16247254

File: 7d8743de60e79f9⋯.png (764.95 KB, 754x759, 754:759, the_armor_of_God.png)

>>16247242

God bless you and keep you from harm, this day and forever.

Amen

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

b0aad6  No.16247255

File: 0c05680a3845c3d⋯.png (225.92 KB, 586x454, 293:227, Screenshot_2022_05_10_05_4….png)

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

64f34d  No.16247256

File: 812213e8442e39c⋯.png (917.16 KB, 727x1000, 727:1000, d3b3477492d5bdce6d7aa5733f….png)

>>16247242

God bless you too Swordy.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

8b539c  No.16247257

>>16247252

documents.

2

Some 5.56mm ammunition recovered by the Air Force OSI agent during the sting was noted as "expended" a year prior by Fairchild personnel, with some rounds discovered in Richards' residence in Nevada after he transferred to Creech Air Force Base, prosecutors allege.

"We are aware of the arrest of the Airmen stationed here at Fairchild Air Force Base," 1st Lt. Michelle H. Chang, a spokesperson for the 92nd Air Refueling Wing, told Military.com in an email. "We have been and continue to work closely with federal law enforcement authorities to provide all relevant information to assist in this ongoing investigation."

Ammunition, "consistent with the stolen ammunition," according to court records, was also discovered in the residences of Sanger, Eagleton, Shawn Robson, Austin Limacher and Jonah Pierce – the other airmen charged in the indictment. Ranks for the four other airmen were not included in court documents.

Last month, U.S. Attorney Vanessa Waldref lauded the joint FBI-OSI investigation, saying "when individuals put their own interests ahead of others and abuse the public trust, those individuals dishonor the countless public servants who dedicate their lives to government and military service."

Military.com attempted to reach the defendants' legal teams for comment, but none replied by publication. Richards did not have an attorney assigned to him, it appeared, according to court records.

The indictment also stated that some members of the group possessed other stolen military equipment, such as red dot optics and PEQ-15 target illuminators.

It is unclear, based on court records, what the group intended to use the ammunition for, though the FBI's affidavit noted several of the indictees did expend some of the ammo through target practice in rural Washington.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

241014  No.16247258

File: 089ce881b8f17af⋯.jpeg (54.45 KB, 640x480, 4:3, A81CBE2E_1B05_45A7_A2F0_C….jpeg)

Scholars Question Mehmet Oz’s Justification for Maintaining Turkish Citizenship

Jordan Dixon-Hamilton9 May 2022

Celebrity doctor Mehmet Oz reportedly maintains his Turkish citizenship to care for his elderly mother, but scholars are questioning the legitimacy of Oz’s reasoning.

Oz’s dual U.S-Turkish citizenship became a focal point of his campaign for U.S. Senate in Pennsylvania after he told reporters in March that he would forego specific security clearances provided to U.S. Senators to maintain his Turkish citizenship.

Oz reportedly maintains his Turkish citizenship to care for his mother, who is battling Alzheimer’s disease. “I can love my country and love my mom,” Oz told reporters in March.

However, after facing backlash for his comments about his Turkish citizenship, Oz pledged to revoke it if the voters of Pennsylvania send him to the Senate in November.

“I maintained it to care for my ailing mother, but after several weeks of discussions with my family, I’m committing that before I am sworn in as the next U.S. senator for Pennsylvania I will only be a U.S. citizen,” Oz said in March.

Still, after he pledged to revoke his Turkish citizenship, Oz maintained that he only kept it so he could visit his parents as recently as two weeks ago.

“President Trump was very clear, I’m America First,” Oz said during Pennsylvania’s Republican Senate primary last month. “I was obliged to serve for two months in the Infirmary in the Turkish military, which I did in order to go visit my parents as I went through my life. I can love my mother, and I can love my country as well.”

In light of Oz’s service in the Turkish military, his endorsement deal with Turkish Airlines, his Turkish real estate portfolio, and his vote in Turkey’s most recent presidential election, scholars are speculating that his mother’s health may not be the true reason he maintains his citizenship in the country.

As American Enterprise Institute senior fellow Michael Rubin pointed out, Oz could still care for his mother without being a citizen of the country. For example, Turkey’s reportedly lax visa process would allow Oz to visit his mother without being a citizen of the country.

As Rubin explained:

Oz could care for his mother regardless of his citizenship status. Until recently, Americans could go to a booth at Turkey’s major international airports and get a Turkish visa for $20. The whole process took less than five minutes, even when there was a line. Oz reportedly has a net worth in excess of $100 million, so the financial strain of getting a visa a few times each year was no deterrent. Today, the process is even easier: U.S. citizens can apply online for an e-visa in advance of their travel and receive their Turkey visa almost instantaneously.

Oz could be considered a foreign agent of Turkey, according to an advocacy group that recently called on the U.S. Department of Justice to investigate Oz for a possible violation of the Foreign Agents Registration Act for his work with Turkish government-backed Turkish Airlines.

(What about all the jews in congress that have dual citizenship, they could be agents for MOS?)

Oz’s Turkish ties have also drawn scrutiny from members of the national security community. Former President Donald Trump’s former national security adviser, Robert O’Brien, recently said Oz’s election to the Senate would be “problematic.”

https://www.breitbart.com/politics/2022/05/09/scholars-question-mehmet-ozs-justification-for-maintaining-turkish-citizenship/

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

784d35  No.16247259

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

e8e24c  No.16247260

File: 1e56aefb657b8fb⋯.png (112.12 KB, 323x293, 323:293, back_atcha_swordy.png)

>>16247242

God bless

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

21eb2a  No.16247261

File: 1e75d43838cd570⋯.mp4 (583.51 KB, 704x848, 44:53, catsmacksnancy.mp4)

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

f6284f  No.16247262

>>16247247

>then you are forced to listen to U2.

That's worse than rape, feltching, Kim Kardashian, Hillary Clinton.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

e24a5d  No.16247263

? ? ? Meme Op ? ? ?

The 'Democrat' Party has stolen your vote with mail in ballot voter fraud covered under the veil of Covid.

We will be taking back the house and securing the senate, #VoteEarly in person and #SaveYourRights

OPERATION: Save Your Rights

DATE: May 3rd - NOV 3rd

FOCUS: Save your rights and Vote Early in the Primaries

DEMOCRAT INTEL AND MEMES: https://archive.ph/jZcGS

Suggested Hashes:

PRIMARY: #Vote #EarlyVoting #VoteEarly #VotePrimaries #PrimaryVoting

SECONDARY: #VoteRinosOut #VoteDemsOut #VoteRed #VoteRepublican #GetOutAndVote #VoteInPerson #GoVote

TERTIARY: #TakeTheHouse #TakeTheSenate #MAGA #WWG1WGA

From Now Until Nov 3rd Please Gather and Share all your Vote Early in the Primaries information Memes/Caps/Vids/Reminders/

Call Family and Friends and Tell them to also get out and Vote Primary For The Win.

? ? ? Meme Op ? ? ?

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

b0aad6  No.16247264

File: 6d9b79a024f7d67⋯.png (92.67 KB, 342x325, 342:325, Screenshot_2022_05_09_01_5….png)

>>16247255

DRAFT for MULES

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

345719  No.16247265

File: ed41882df5ccbd6⋯.png (277.31 KB, 500x586, 250:293, bugs.png)

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

8b539c  No.16247266

>>16247257

https://www.military.com/daily-news/2022/05/09/6-airmen-caught-thousands-of-rounds-of-stolen-ammo-federal-indictment-alleges.html?utm_medium

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

8b539c  No.16247267

>>16247266

Leans left…

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

3580c7  No.16247268

>>16247239

Might want to include this one:

Eric Lichtblau

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

b0aad6  No.16247269

File: d3399c158800458⋯.jpeg (65.21 KB, 680x550, 68:55, NED_democracy.jpeg)

A child fucker and drug addict is going to start ww3 and exterminate everything on Earth.

Let that sink in.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

e21051  No.16247270

>>16247246

who is Azra Turk ?

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

21eb2a  No.16247271

File: 885a232be3a0c32⋯.png (371.12 KB, 618x498, 103:83, bonoglasses.PNG)

>>16247247

getting bombed so hard u2 gives free concert

no masks for covid

no vaccine needed

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

8cb4ba  No.16247272

File: 3ce4bb0cebd8fa5⋯.png (1.25 MB, 636x948, 53:79, ClipboardImage.png)

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

e24a5d  No.16247273

File: 5f7fd3653703a72⋯.png (30.5 KB, 1028x709, 1028:709, primaries.png)

>>16247263

MAY 10th Primaries

Nebraska and W Virginia

Optics and Push for our Guys

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

e8e24c  No.16247274

File: 525d6d191350578⋯.png (605.28 KB, 703x524, 703:524, bidan_klaus.png)

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

e24a5d  No.16247275

DAILY CHECKOFF ROUTINE

Notables

4am Talking Points

Their media Narration

Q Deltas & Clock

Daily Unified Anon Prayer Storm 7pm EST

OPTICS

:Russell-Jay: Gould. LastFlagStanding.com

ChuckGrassley: https://twitter.com/ChuckGrassley

Dan Bongino: https://bongino.com/ | https://twitter.com/dbongino | rumble.com/c/Bonjino

Dan Scavino: https://twitter.com/DanScavino/ | https://www.facebook.com/DanScavino/ | https://t.me/Dan_Scavino_Official/ | TS@DanScavino

Devin Nunes: TS@DevinNunes

Donald J Trump: https://www.donaldjtrump.com/ | https://gab.com/realdonaldtrump | rumble.com/c/DonaldTrump | Truthsocial.com

Donald Trump Jr: https://twitter.com/DonaldJTrumpJr/ | https://www.rumble.com/c/DonaldJTrumpJr

General Flynn: https://parler.com/profile/GenFlynn/ | https://www.generalflynn.com/ | t.me/RealGenFlynn | TS@TrueGenFlynn

George Papadopoulos: https://twitter.com/GeorgePapa19

Jack Posobiec: https://twitter.com/JackPosobiec/

Jeanine Pirro: https://twitter.com/JudgeJeanine

Jim Jordan: https://twitter.com/Jim_Jordan

John Solomon: https://twitter.com/jsolomonReports

Kash Patel: TS@Kash | fightwithkash.com

Laura Ingraham: https://twitter.com/IngrahamAngle

Liz Harrington: https://twitter.com/MZHemingway | TS@realLizUSA | https://twitter.com/realLizUSA | https://twitter.com/lizharrismba

Lou Dobbs: https://twitter.com/LouDobbs

Maria Bartiromo: https://twitter.com/MariaBartiromo

Marjorie Greene: https://twitter.com/mtgreenee/ | https://twitter.com/RepMTG

Melania Trump: https://twitter.com/melaniatrump/

Mike Lindell: https://frankspeech.com/ | https://LindellTV.com/

Mike Pompeo: https://twitter.com/mikepompeo/

q: TS@q

RepMattGaetz: https://twitter.com/RepMattGaetz

Ron Watkins: https://t.me/CodeMonkeyZ | https://t.me/codemonkeyzchat | helpwatkinswin.com

Rudolph Giuliani: https://twitter.com/RudyGiuliani/ | https://www.rumble.com/c/TheRudyGiuliani

Sara Carter: https://twitter.com/SaraCarterDC

Sean Hannity: https://twitter.com/seanhannity

Sebastian Gorka: https://twitter.com/SebGorka

Sidney Powell: https://defendingtherepublic.org/

Steve Bannon: https://warroom.org/listen-live/ | https://americasvoice.news/

Tom Fitton: https://twitter.com/TomFitton/

Socials: Twitter.com | Facebook.com | Gab.com | Patriots.win | TruthSocial.com | Poal.co | 4chan.org | AboveTopSecret.com

Videos: Youtube.com | Rumble.com | Bitchute.com | Brighteon.com | Tora3.com | Vimeo.com

Media: @RSBNetwork | @OANN | @Newsmax | Warroom.org |@News_ntd | t.me/WeTheMedia | UncoverDC.com | TheEpochTimes.com | JustTheNews.com | FrankSpeech.com | AmericasVoice.news | InfoWars.com | thegatewaypundit.com

Civilian:

Jim Watkins: https://gab.com/jimwatkins

In The Matrix: MG.show

Kanekoa: https://gab.com/KanekoaTheGreat https://rumble.com/user/kanekoathegreat

Technofog: technofog.substack.com

Amazing Polly: https://www.bitchute.com/channel/ZofFQQoDoqYT/

Mr Pool: https://twitter.com/Ioop_rM311_7211

Diamond and Silk: https://rumble.com/c/DiamondandSilk

Americas Front Line Doctors: Rumble.com/c/DrSimoneGold

Charlie Kirk: https://rumble.com/c/CharlieKirk

Ben Shapiro: https://rumble.com/c/BenShapiro

Cat Turd: https://twitter.com/catturd2

Praying Medic: https://t.me/praying_medic/

PapiTrumpo: https://twitter.com/PapiTrumpo_

John McCaffee: https://t.me/McafeeAfterlife/

George News: https://www.youtube.com/channel/UCHuJRxaJssaumjcv9aLZ21Q

Military: https://controlc.com/10a2f775

@USArmy @USNavy @USMC @usairforce @SpaceForceDoD

Plane Tracking: https://www.radarbox.com/

Military Ship Tracker: https://www.shiplocation.com/military/tracker

Hash Trends: https://trends24.in/united-states/

Meme Request: >>15406820

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

241014  No.16247276

>>16247258

>>16247258

I think Trump backed him for various reasons, they were “supposedly friends”, maybe he did it to expose him without him getting all of HW working against him. Or he knew others would get so outraged they’d run against him, like Kathy Barnette is doing now. She’s spent $150,000 and he and the other guy has spent millions; and she’s catching up to both of them.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

de9a9a  No.16247277

Normies on the Twattersphere are shitting themselves over 2000 mules.

Argument I'm most commonly seeing: "They made it all up."

Most don't even realize that this whole thing was set off by a few of the mules coming forward months ago.

The 5-10% are having reptilian conniption fits desperately trying to dismiss what's right in front of them.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

8b539c  No.16247278

>>16247267

https://mediabiasfactcheck.com/military-com/

a tool

History

Founded in 1999, Military.com is a website designed to appeal to current and former members of the U.S. military plus “those considering joining, and military enthusiasts and supporters.” Military.com publishes news related to the military and benefits for its members. The current editor is Hope Hodge Seck.

Read our profile on the United States government and media.

Funded by / Ownership

Military.com is owned by Monster Worldwide, a subsidiary of Randstad Holding, a Dutch multinational human resource consulting firm headquartered in Diemen, Netherlands. Revenue is primarily generated through advertising.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

50658c  No.16247279

File: 8c066dcfff14048⋯.png (238.8 KB, 500x625, 4:5, honeypot.png)

>>16247270

nothing but trouble.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

1f4106  No.16247280

File: 3a0ae62f54eeaf9⋯.jpg (177.19 KB, 1532x1095, 1532:1095, media_a249ce8717ea46eab551….jpg)

>>16247247

you wont have to imagine after the WHO votes to takeover on May 22. You too will likely have the privilege.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

e24a5d  No.16247281

>>16247264

thats a lot of ass anon

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

241014  No.16247282

File: 4cb3783a1787570⋯.jpeg (84.04 KB, 640x480, 4:3, A3F9505D_2228_4C6A_8A7F_D….jpeg)

Democrats’ Bill to Codify ‘Roe’ and Abortion Omits the Word ‘Woman’

Democrats are defending Roe v. Wade as the foundation of women’s rights, but their bill to codify Roe into law lacks the word “woman,” and only mentions the word “women” in the title.

The move to codify Roe began as an attempt to fulfill a campaign promise by President Joe Biden, who said that he would urge Congress to pass a law to make abortion legal nationwide in the event that a conservative Supreme Court struck down the controversial 1973 precedent that granted a “right” to abortion.

That pledge has become more urgent since last week, when a majority opinion by Justice Samuel Alito striking down Roe in the Dobbs v. Jackson Women’s Health Organization case was leaked to the media, triggering alarm among Democrats.

But the 2021 bill to codify Roe, the Women’s Health Protection Act, did far more than that. It also included radical provisions on gender, including the proclamation that biological women who identify as transgender men can also become pregnant:

The terms “woman” and “women” are used in this bill to reflect the identity of the majority of people targeted and affected by restrictions on abortion services, and to address squarely the targeted restrictions on abortion, which are rooted in misogyny. However, access to abortion services is critical to the health of every person capable of becoming pregnant. This Act is intended to protect all people with the capacity for pregnancy—cisgender women, transgender men, non-binary individuals, those who identify with a different gender, and others—who are unjustly harmed by restrictions on abortion services.

In addition, the bill included other radical provisions on “reproductive justice,” calling it a fight against “white supremacy.”

Byron York of the Washington Examiner noted Monday that the 2022 version of the Women’s Health Protection Act had stripped out the radical “roots” of the legislation. However, the new legislation failed to include the word “woman” at all (original emphasis):

The 2021 bill is, in many ways, the bare, exposed id of today’s Democratic Party. It is filled with the kind of language that turns off voters in the vast middle of the electorate — Democrats, Republicans, and independents. And that is why, now that the Supreme Court leak has pushed abortion to the front of the political debate, and with midterm elections on the way, Democrats have removed all that language from the 2021 version of the bill.

That stuff about Reproductive Justice? It’s gone. About BIPOC? It’s gone, too. Nonbinary people? Gone. White supremacy? Nowhere to be found. Now that Democrats know the public will be watching, thanks to the Supreme Court leak, they don’t want people to see what they really think about abortion.

One notable aspect of the 2021 bill has made it into the 2022 bill. Even though it is known as the “Women’s Health Protection Act,” the title is the only place in the entire 2022 bill where the word “women” or “woman” appears. Instead, the2022 bill is designed to cover any “person” who is pregnant. It describes its purpose as protecting “a person’s ability to determine whether to continue or end a pregnancy,” and it would strike down any effort to “interfere with a person’s ability to terminate a pregnancy [or] to diminish or in any way negatively affect a person’s constitutional right to terminate a pregnancy.”

Senate Majority Leader Chuck Schumer (D-NY) has scheduled a vote on the bill for later this week.

https://www.breitbart.com/politics/2022/05/09/democrats-bill-to-codify-roe-abortion-omits-the-word-woman/

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

1f4106  No.16247283

File: 1124efc354ab266⋯.jpg (52.23 KB, 750x484, 375:242, marinaoz1_750x484.jpg)

>>16247258

she looks like Ana Kasparian

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

b0aad6  No.16247284

File: ec2801c9cbba1bd⋯.png (443.56 KB, 581x536, 581:536, Screenshot_2022_05_10_05_5….png)

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

e0487e  No.16247285

Someone tell me I've been "broken" since childhood. I've never liked:

1. Disney

2. U2

This is serious, and I have friends going back 31 years that can attest to this. I've hated their cartoons, movies, the theme park was garbage in comparison to Six Flags (I always felt), and as far as U2 goes, I just had no idea why such a horrible, talentless group of musicians could've ever gotten to the level of stardom they did. After all this, here with anons, I "get it" now. Most of this shit was force-fed to the masses to get their adulation. I have a few friends that agree on U2, but the Disney shit's got a lot of people behind it.

It's perplexing as hell to me.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

1f4106  No.16247286

File: 78f6d4466bd9497⋯.jpg (117.14 KB, 835x705, 167:141, csac.JPG)

>>16247269

https://www.ned.org/experts/nick-benequista/

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

54d19b  No.16247287

>>16247258

So what about all of the members of Congress who hold an Israeli citizenship?

Will they be forfeiting their dual citizenships, or nah?

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

e21051  No.16247288

>>16247279

nice pic , who's the tease now :)

a name to go with the alias is all we need

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

784d35  No.16247290

>>16247239

That would be a damn good start. I can think of a few more to add to this list. B737-800 would hold all of them plus the ones to be added for a one way flight to Guantanamo Bay, Cuba.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

181e21  No.16247291

File: 6ba893c53e9ff5c⋯.png (474.33 KB, 1920x1440, 4:3, ClipboardImage.png)

>>16247247

>and then you are forced to listen to U2.

Doing Bon-Jovi covers

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

778aae  No.16247292

File: 6d89e03af7d7b21⋯.png (1.35 MB, 1099x1235, 1099:1235, ClipboardImage.png)

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

b0aad6  No.16247293

File: 14f3524139db68c⋯.png (104.04 KB, 626x464, 313:232, ass.png)

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

50658c  No.16247294

>>16247288

luls

Turk, whose real name is unknown, traveled to London to work with Cambridge University professor Stefan Halper, a longtime FBI informant whom the feds had told to set up a meeting with Papadopoulos, according to the Times.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

e8e24c  No.16247295

File: 0f0ec53da895fb1⋯.png (1014.14 KB, 745x1041, 745:1041, tyb.png)

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

498b4d  No.16247296

File: 22f7224a690b00d⋯.jpg (64.72 KB, 730x483, 730:483, this_day_in_history_051020….jpg)

File: e4fd5f8923129eb⋯.jpg (81.63 KB, 900x590, 90:59, i_have_covid_again.jpg)

File: b32b47d716cb849⋯.jpeg (158.24 KB, 770x571, 770:571, 49aff755a3990106.jpeg)

>>16247242

Good morning Swordy.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

ac3b4a  No.16247297

Did anybody download the voter roll from Wisconsin, before they deleted it?

https://twitter.com/TeethLiberty/status/1523861332084285442

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

241014  No.16247298

File: f9478f19e08f883⋯.jpeg (72.17 KB, 640x480, 4:3, F496737F_FC5B_401E_B0F7_E….jpeg)

Anthony Fauci Rails Against the ‘Normalization of Untruths’ in Commencement Speech

Hannah Bleau9 May 2022

Fuck Off Fauci

Dr. Anthony Fauci (a serial liar), a serial flip flopper in the era of the Chinese coronavirus, railed against the “normalization of untruths” and “so-called news organizations” during his commencement speech at the University of Michigan over the weekend.

“Being in Washington has allowed me to experience first hand the intensity of the divisiveness in our nation,” Fauci told the graduates during the roughly 15-minute speech.

“What troubles me is that differences of opinion or ideology have in certain circumstances been reflected by egregious distortions of reality,” he said.

It is a perplexing claim, given the fact that Fauci himself has altered his positions on a variety of issues — from the efficacy of masks to forced vaccines — over the course of the pandemic. Notably, prior to the pandemic, Fauci once dismissed masks as a “paranoid” tool, and early on in the pandemic, he admitted that drugstore masks are “not really effective in keeping out virus, which is small enough to pass through the material.” Yet, he publicly went on to become a champion of forced masking, violating his own purported beliefs at his own convenience:

He made a similar move recently, refusing to attend the White House Correspondents’ Dinner due to the risk of contracting the coronavirus, yet he attended a White House Correspondents’ Association garden party over that same weekend.

However, Fauci ignored his own displays of hypocrisy in the speech, insisting that “elements of our society have grown increasingly unfazed by a cacophony of falsehoods and lies that often stand largely unchallenged, ominously leading to an insidious acceptance of what I call the normalization of untruths.”

Fauci also complained about “certain elected officials in positions of power” and “so-called news organizations” during the speech.

Ultimately, Fauci charged graduates with the responsibility to refuse to accept the “normalization of untruths.”

“If you remember nothing else from what I say today, I truly appeal to you, please remember this: It is our collective responsibility not to sink to a tacit acceptance of a normalization of untruths because if we do, we bring danger to ourselves, our families and our communities,” Fauci said.

Sen. Rand Paul (R-KY) is among critics who have challenged Fauci’s way of thinking, concluding that the White House medical adviser does not want anyone to question his positions.

He thinks that his edicts should stand, no court or Constitution should review his edicts, and no individual person should get the choice to make it,” Paul said.

https://www.breitbart.com/politics/2022/05/09/anthony-fauci-rails-against-the-normalization-of-untruths-in-commencement-speech/

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

e24a5d  No.16247299

>>16247297

check wayback archive

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

f167db  No.16247300

>>16247209 (LB)

>My father taught me this most valuable lesson…

He said:

Son, life is simple.

It's either cherry red.

Or midnight blue.

Whoahhhhhh ohhhhhh oh.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

ac3b4a  No.16247302

>>16246648 pb

>Prison officer who fled with prisoner on retirement shoots herself

bullshit they shot her

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

50658c  No.16247303

File: 7831f4bbdb4a77f⋯.png (112.92 KB, 258x300, 43:50, 1111.png)

workfag out

o7

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

83625a  No.16247304

Stacey Abrams ran mules out of her headquarters in Georgia…

hmmm, yea, she does look like a MULE TAMER…probably got tired of doing nightly shows with them…

Let's see, Dems allow, dead people, illegal people, people from other states to vote, hell, why not mules…after all they are the party of the JACKASS's…

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

6e3f7f  No.16247305

File: 673873c6552fe47⋯.jpeg (1.23 MB, 1950x1281, 650:427, 671FA318_202E_4A66_8F9B_3….jpeg)

TRUE THE VOTE AND 2000 MULES FACT CHECK THE "FACT CHECKERS", DEBUNK AP HIT PIECE

By Wendi Strauch Mahoney of UncoverDC

"2000 Mules, a 90-minute documentary produced by Dinesh D’Souza, is the visual tip of the ballot trafficking iceberg based on the digital evidence collected by True the Vote (TTV) and OPSEC.

Utilizing geospatial technology to ping cellphones using data from apps, Catherine Engelbrecht, founder of TTV, coordinated with Gregg Phillips’ OPSEC team of cyber analysts to establish a “pattern of life.”

They then corroborated those anonymous cellphone data trails with publicly available dropbox surveillance videos.

Phillips has been doing highly specialized work on elections globally for forty years but the technology used in this project has only been around for the past few years.

The AP published a “hit piece” on May 3, attempting to expose TTV’s “flawed analysis of cellphone location data and ballot drop box surveillance footage” presented in 2000 Mules. We will examine those claims, weaving in information from the movie and conversations with Engelbrecht over the weekend."

https://www.truethevote.org/true-the-vote-and-2000-mules-fact-check-the-fact-checkers/

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

13884c  No.16247306

File: a0cd0d24fc4bf14⋯.jpg (60 KB, 517x463, 517:463, tyvh.jpg)

White people are the elite race in America and they are going tribal again in a Big Way.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

21eb2a  No.16247307

File: ea84f3b7765a900⋯.png (376.06 KB, 1232x396, 28:9, ClipboardImage.png)

https://www.msn.com/en-us/news/us/a-second-maga-clerk-in-colorado-also-breached-voting-machines/ar-AAX6hzp?ocid

After a months-long court battle, Colorado officials have finally retrieved hard drives containing data that was smuggled from a county’s voting machines. But it’s still unclear who accessed that data—or what a conspiracy-promoting set of Coloradans hope to do with it.

Following a court order last Wednesday, Dallas Schroeder, clerk of Elbert County, Colorado, returned two hard drives containing his county’s election machine data. Schroeder previously testified that he copied the sensitive data last August, with help from a pair of Colorado conspiracy theorists linked to MyPillow CEO Mike Lindell. Schroeder says he initially gave one copy of the data to his attorney John Case, and another to an unnamed lawyer.

Schroeder, who did not return a request for comment, is the second Colorado clerk accused of breaching voting machines under his supervision. The other clerk, Tina Peters of Mesa County, is currently facing a barrage of criminal charges for allegedly stealing a local tech worker’s identity, illegally copying her county’s election data, and leaking it to election fraud conspiracy theorists last spring. She later appeared at Lindell’s “cyber symposium” on supposed voter fraud where she implied, incorrectly, that the stolen data suggested election malfeasance against Donald Trump.

Two weeks after the symposium, Schroeder made copies of similar elections data in his own county. Surveillance footage, reported by Reuters last month, shows Schroeder “fiddling with cables and typing on his phone as he copied computer drives containing sensitive voting information.”

Some of Schroeder’s communications that day were with Shawn Smith and Mark Cook, a pair of election truthers who have promoted their conspiracy theories on Lindell’s “Lindell TV” webshow. Smith, who has previously stated that Colorado’s secretary of state “deserve[s] to hang” if involved in election fraud, also leads Cause of America, a Lindell-backed election denialism group. Schroder testified that he copied the voting machine data using a “Logic Cube Forensic Falcon Neo Device,” a $4,000 device that he borrowed from and subsequently returned to Cook.

Schroeder also testified that on Sept. 2, he returned to make a second copy of the data, which he gave to an attorney whom he has so far refused to publicly name. He was allowed to give the attorney’s name to a judge under seal last week, preventing the person’s name from entering the public record.

Although Schroeder testified that no one had accessed his own copy of the election data, the leaked information has nevertheless become fodder for conspiracy theorists who claim the breach might contain information that finally proves election fraud.

Stop The Steal types in Colorado have called for breaches of voting machines on the basis of a conspiracy theory that falsely accuses state officials of wiping those machines. (Peters, the Mesa County clerk, also cited the theory in her alleged breach of voting machines.) Schroeder, along with a small group of fellow Republican clerks, invoked the conspiracy theory in their own lawsuit against state officials in November. Ironically, Schroeder’s own affidavit in that case revealed that he had made unauthorized copies of his county’s election machine data.

Following the revelation of the Elbert County leak in January, fringe bloggers have implied without proof that figures in the conspiracy world had reviewed the data. But one such recent claim appeared in a less-obscure source: a Lindell-backed lawsuit by a pair of Arizona political figures.

Lindell is underwriting a lawsuit by Arizona state representative Mark Finchem and Arizona gubernatorial candidate Kari Lake, the Arizona Republic reported. The suit seeks to bar the use of electronic voting machines, which have become a fixation of election truthers. An initial complaint in the case, filed late last month, claimed to cite data from both Mesa County and Elbert County voting machines as evidence that those machines were unreliable.

“Dominion Democracy Suite software was used to tabulate votes in 62 Colorado counties, including Mesa County and Elbert County, during the 2020 election,” the original complaint read. “Subsequent examination of equipment from Mesa County and Elbert County showed the Democracy Suite software created unauthorized databases on the hard drive of the election management system servers.”

Never mind that the Mesa County election data did not show foul play—the Elbert County data is not supposed to be public at all, and not even conspiracy theorists have made concrete claims about what it supposedly reveals.

On April 4, Lake and Finchem amended their complaint. An updated version of the complaint now only names Mesa County.

concrete

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

54d19b  No.16247308

>>16247235

If anyone thinks that any of these mules are going to be arrested, they are sadly mistaken. They will be used and paid for their services again in Nov. 2022, they did such a good job in 2020.

Our Justice System is as much of a joke as our Elections.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

262f82  No.16247309

Whatever happened to the "Asian Hate" narrative?

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

eb8a34  No.16247310

File: 44694f44922364c⋯.png (185.57 KB, 570x436, 285:218, aa0874bca4bc200f5e74d08da6….png)

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

54c3ec  No.16247311

File: ee3ab97c8ee507d⋯.png (358.7 KB, 711x933, 237:311, Barnette.png)

File: 798c36e12d7aede⋯.png (82.54 KB, 694x534, 347:267, Barnette_poll.png)

>>16247276

>>16247276

Trump should endorse Barnette

I heard on Bannon a long time ago and was thoroughly impressed. She has the "it" factor.

Oz and McCormick are trash.

Also Politico is calling her bad because she's "Ultra MAGA",

And unlike Oz, she truly believes the 2020 election was stolen and has brings up FACTS and details about it. Oz is just saying it because of the Trump endorsement..

She's rocketing in the polls because she's real and authentic, Oz is just playing lip service to MAGA and it shows.

McCormick hates America and MAGA, so fuck him.

>https://www.politico.com/news/2022/05/10/kathy-barnette-pennsylvania-senate-gop-primary-00031262

>https://www.inquirer.com/politics/election/pa-senate-race-poll-barnette-oz-mccormick-20220509.html

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

1f4106  No.16247312

File: aac4924b8728d39⋯.jpg (122.49 KB, 786x494, 393:247, khjbhb.JPG)

File: d00cbd80c81c728⋯.jpeg (860.95 KB, 896x4113, 896:4113, Web_capture_10_5_2022_756….jpeg)

>>16247258

This is in Dr. Oz district:

Dear Patient,

Due to unprecedented COVID-related supply chain disruptions in

China, all hospitals in the United States are experiencing a shortage of contrast media (sometimes referred to as X-ray dye) used to perform CAT or CT scans. This may affect ERCP procedures as well. As at all U.S. hospitals, LVHN and other imaging providers’ ability to perform these scans in all but the most critical cases will be limited until these supply chain issues are corrected. This shortage has been caused by the Chinese government’s COVID lockdown of Shanghai, where most of the world’s supply of contrast media is manufactured and then subsequently distributed by GE Healthcare and Bracco. This disruption is expected to last until at least the end of June.

LVHN is exploring various strategies to conserve contrast media, including using other imaging technologies and materials and postponing non-emergency scans. As always, we are 100% committed to providing the best possible care to our patients. If you have any questions or concerns about a scheduled test at LVHN, please contact the scheduling department at LVHN at 610-402-8378.

Facebook

LinkedIn

Website

Copyright © 2022 Eastern Pennsylvania Gastroenterology & Liver Specialists, All rights reserved.

You are receiving this email because you opted in via our website.

Our mailing address is:

Eastern Pennsylvania Gastroenterology & Liver Specialists

1501 N Cedar Crest Blvd

Allentown, PA 18104-2309

https://godlike.com/forum1/message5131871/pg1

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

6e3f7f  No.16247313

File: deec4e772bea5e1⋯.png (285.12 KB, 890x864, 445:432, 410A26AB_120A_4788_A56E_34….png)

>>16247305

https://uncoverdc.com/2022/05/09/2000-mules-and-true-the-vote-debunk-ap-hit-piece/

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

e24a5d  No.16247314

Twitter embed. Click thumbnail to play.

Lori Lightfoot Call to Arms

So i guess we are just going to ignore this mess of a person

https://twitter.com/LoriLightfoot/status/1523844510735908864

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

784d35  No.16247315

>>16247287

Amend the Constitution to read that no member of congress nor any employee of the federal government shall be employed, elected or appointed while holding duel citizen nor have any other allegiance to any other nation than the United States.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

e0487e  No.16247316

File: fb4090723b05e04⋯.png (215.22 KB, 590x600, 59:60, Sword_Woman.png)

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

1f4106  No.16247317

File: ae775d6df7ab148⋯.jpg (49.41 KB, 528x366, 88:61, datrueture.JPG)

>>16247313

anon raises

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

4cf6cf  No.16247318

File: 1c0eb6935043ec6⋯.png (329.7 KB, 471x322, 471:322, bono_spacey_trudeau.PNG)

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

3580c7  No.16247320

File: 31f7e112eac7bee⋯.jpg (3.67 MB, 4633x2601, 4633:2601, Ocean_Drover.jpg)

>>16247290

No more upolstered seating, rent a livestock carrier and let 'em make the journey by Sea

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

2d83e4  No.16247321

File: 4106c17b0afa63c⋯.png (363.09 KB, 400x400, 1:1, Screenshot_2022_05_07_at_2….png)

>>16247271

>getting bombed so hard u2 gives free concert

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

345719  No.16247322

File: 4e697a75954189f⋯.png (252.09 KB, 578x432, 289:216, fauci_science_.png)

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

64f34d  No.16247323

File: 4cc1d2dee4eedc9⋯.png (484.85 KB, 654x913, 654:913, Screenshot_2022_05_10_at_1….png)

Fort Lee Drill Sergeant Fired After Arrest in Underage Prostitution Sting Operation

A drill sergeant at Fort Lee, Virginia, has been fired from his position after being arrested in March on felony charges of soliciting prostitution with a minor as part of a police sting operation.

Staff Sgt. Cody Osmun was assigned to Alpha Company, 832nd Ordnance Battalion, and was tasked with training new soldiers coming into the Army. In addition to his drill sergeant duties, he is a Bradley Fighting Vehicle system maintainer.

Osmun, who was assigned to Fort Lee in 2020, was fired after his arrest on March 31, according to a spokesperson for the installation. He was charged but has not been convicted of any crime. The arrest came as part of a weeks-long operation by local authorities in Chesterfield Country, Virginia, just south of the capital Richmond.

He was one of 16 people caught by law enforcement in a series of sting operations over the last month, according to reporting from WHSV 3. The suspects converged at a location where they thought they were meeting with a minor for paid sex, but it was a trap set by authorities.

Osmun has numerous criminal infractions, mostly traffic violations, stretching back a decade, according to court records.

However, in May 2021, he was arrested and found to have been driving with a blood alcohol level of twice the legal limit. His license was suspended for a year, and he was sentenced to six months of unsupervised probation, according to court documents.

https://www.military.com/daily-news/2022/05/06/fort-lee-drill-sergeant-fired-after-arrest-underage-prostitution-sting-operation.html

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

25912e  No.16247324

Tora3 embed. Click thumbnail to play.

Countering Disinformation is our middle name.

Ahoy! Phase 1 AM

https://tora3.com/share/c9bf927689ff_ef521d3833a7dc2436747b_0f7cb5020c8336

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

b0aad6  No.16247325

File: 84a6dcfaef05236⋯.jpg (70.26 KB, 640x400, 8:5, the_squaDT.jpg)

>>16247315

It's annoying to watch you guys flipping around like fresh caught fish scratching at the steel door like a kitten nobody can hear.

remove commie marxist nazi fascist maoist eugenicist lenonist socialist globalist terrorist pedoist and identity fraud

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

54d19b  No.16247326

File: 25bf37b5a88b95d⋯.png (1.92 MB, 1920x1080, 16:9, ClipboardImage.png)

>>16247308

>>16247235

The more likely scenario is that they will end up suing someone and will get millions of dollars for defamation or some such nonsense.

Look at the yahoos with the suitcases in Atlanta.

Every single news organization says they are not ballots. There was no election fraud. Anyone who thinks that there was election fraud is a Crazy Conspiracy Theorist.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

6e3f7f  No.16247327

File: 99119d5c7865a63⋯.jpeg (40.46 KB, 255x300, 17:20, A614845E_B058_4CC0_A648_6….jpeg)

File: 785c16ba3caa95d⋯.jpeg (30.63 KB, 400x255, 80:51, D2C79638_7226_45F6_8CF5_B….jpeg)

File: 02bf1379b4aa5fc⋯.jpeg (51.15 KB, 500x255, 100:51, CFE21300_AC07_4C03_9EA3_7….jpeg)

File: 16cd553f761a355⋯.jpeg (63.41 KB, 500x255, 100:51, 2CCB5F62_C433_4FD9_BE7E_0….jpeg)

>>16247305

>>16247313

https://uncoverdc.com/2022/05/09/2000-mules-and-true-the-vote-debunk-ap-hit-piece/

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

0eb0fa  No.16247328

File: b5f0ebd2280c942⋯.jpeg (227.51 KB, 1156x1754, 578:877, FSWvEeVXoAU2RxN.jpeg)

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

e24a5d  No.16247329

>>16247314

LORI LIGHTFOOT REPORTED FOR INCITING VIOLENCE

ANONS WERE ARE YA???!!!

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

e8f41d  No.16247330

File: 8d756cc76363e8e⋯.png (230.61 KB, 467x570, 467:570, pepe_armor_of_god.png)

>>16247242

o7 swordy!

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

784d35  No.16247331

>>16247311

I like this woman. She is solid and I'm wondering why it is that POTUS endorsed Oz over her? She is a staunch MAGA supporter. WTF?

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

112eda  No.16247332

File: 099e7318d2502b7⋯.png (225.95 KB, 791x462, 113:66, ClipboardImage.png)

File: 1de0c08efa65fe3⋯.png (553.26 KB, 775x542, 775:542, Hussein_point_left.PNG)

PAT44 USAF G5 departed JBA ne

Priority Air Ttransport

It was one of these ACs that was 'in front' (of empty callsign Joe and kneepads) at the Warsaw/Rzesow stops (PAT78 on that occasion)

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

bf4447  No.16247333

File: 3c789529c8e41c7⋯.jpg (326.19 KB, 1297x1903, 1297:1903, diechristlicheku18deut_002….jpg)

File: aeca44c337c86d6⋯.png (959.91 KB, 674x770, 337:385, PtolemaicEgypt2.PNG)

File: 58eaca51f777772⋯.png (605.01 KB, 725x466, 725:466, judgement.PNG)

File: 4520196998dff18⋯.jpg (302.88 KB, 1218x1916, 609:958, diechristlicheku02deut_039….jpg)

File: 978b7f913b52a58⋯.jpg (395.01 KB, 1309x1919, 1309:1919, diechristlicheku02deut_037….jpg)

>>16247179

tyb!

https://archive.org/search.php?query=creator%3A%22Deutsche+Gesellschaft+f%C3%83%C2%BCr+Christliche+Kunst%22

https://archive.org/search.php?query=title%3A%28%2Agypt%29%20AND%20date%3A%5B1830-01-01%20TO%201945-01-31%5D

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

1f4106  No.16247334

File: 5681f985317042d⋯.jpg (40.35 KB, 354x367, 354:367, WakeYoSef.JPG)

>>16247331

anons are exposing the shitstem, not supporting or participating in it

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

784d35  No.16247335

>>16247281

Sure is!! kek

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

241014  No.16247336

Pennsylvania Senate Poll: Dr. Oz Narrowly Leads Three-Way Race

Paul Bois8 May 2022

A recent poll in the Pennsylvania Republican primary for U.S. Senate puts Dr. Mehmet Oz narrowly in the lead for what now looks like a three-way race among the top contenders.

According to the Trafalgar Group poll,Dr. Mehmet Oz holds the top spot, with 24.5 percent of support, while Kathy Barnette trails closely behind him, with 23.2 percent of support. Dave McCormick stands in third with just 21.6 percentof support. Way down in fourth and below double-digits, Jeff Bartos has a meager 7.2 percent of support, while Carla Sands has only 6.5 percent.

Conducted between May 5 – 8 with a 2.99 percent margin of error, the survey questioned 1,080 likely Republican voters. A full 15 percent remain undecided, and should more candidates drop from the race, the numbers for any of the top contenders would likely go up.

Mostly due to his celebrity and the endorsement from former President Donald Trump, Dr. Mehmet Oz has continuously held the top slot, though his grip has been slipping in recent weeks as conservatives question his fealty to issues like abortion and gender indoctrination, not to mention his dual-citizenship with Turkey. As Breitbart News profiled over the weekend, the celebrity doctor was met with more than a fair share of boos during an appearance at a Trump rally over the weekend:

Trump brought his “Save America” rally series to Pennsylvania in support of Oz’s candidacy for U.S. Senate. Along with Trump, Ohio Republican Senate nominee J.D. Vance, Rep. John Joyce (R-PA), Rep. Mike Kelly (R-PA), Jim Bognet, Rep. Alex Mooney (R-WV), Dinesh D’Souza, Mike Lindell, and Oz were slated to speak at Friday night’s rally.

However, Oz faced boos from the crowd before he took the stage. According to the rally’s attendees, the crowd booed Oz as his ads played on screen.

“I have yet to meet anyone here who is a firm supporter of Dr. Oz. In fact, there’s a whole section of people that boos every time he appears on screen,” Huffington Post reporter Daniel Marans tweeted.

Meanwhile, Kathy Barnette’s star power has been steadily rising with conservatives and the MAGA Trump base, especially after releasing her powerful video in which she decried abortion by citing her own beginnings as a child conceived in rape when her mother was just age 11.

“I’m the byproduct of rape. My mother was eleven when I was conceived,” she tweeted. “In the world the Left desires, I would never have been born. We need leaders with a steady hand to direct our nation through these difficult discussions.”

Later, during a debate, Barnette hit Dr. Oz over his past statements in favor of abortion, although he has since claimed to have changed his mind in favor of the pro-life cause.

“It was very disturbing when I saw Mehmet Oz running for this particular race, when I’ve seen him on numerous occasions and specifically at the Breakfast Club, saying that my life was nothing more than an acorn with electrical currents,” she said.

The Republican primary for the Pennsylvania U.S. Senate seat will take place on May 17.

https://www.breitbart.com/politics/2022/05/08/pennsylvania-senate-poll-dr-oz-narrowly-leads-three-way-race/

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

54c3ec  No.16247337

>>16247331

I don't think he thought she had a chance.

He wanted to back a winner and thought the TV recognition of Oz combined with his endorsement would be a winning proposition.

I realized in 2018 Trump chooses candidates based on their odds of winning, not their stances.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

784d35  No.16247338

>>16247334

Fuck you talking about anon?

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

778aae  No.16247339

File: cb089e42a68d770⋯.png (210.75 KB, 480x360, 4:3, ClipboardImage.png)

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

2d83e4  No.16247340

File: 36e46acad64eb0a⋯.gif (997.49 KB, 425x259, 425:259, assangesmile.gif)

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

ab6662  No.16247341

>>16247308

>>16247326

If something in the culture is wrong, but nobody seems to be willing to correct, it then you can be pretty sure the Freemasons are involved in the details.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

ec4e7e  No.16247342

A hinny is the offspring of a male horse and a female donkey. Mules and hinnies are

nearly always sterile and cannot reproduce; therefore every mule or hinny is a hybrid horse/donkey cross.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

f167db  No.16247343

>>16247326

>Every single news organization says they are not ballots.

That's right.

They were industrial strength Lysol wipes that only look like paper on vidya.

They were needed to prevent getting Covid from the ballots.

>t. CNN/MSNBC by way of Snopes

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

13884c  No.16247344

File: 4aef06962a545d3⋯.png (144.38 KB, 585x427, 585:427, downloadfile_2_prev_ui.png)

>>16247311

Everything I post is my research and not some dilapidating faggotLarper's research in a DC think tank.

Trump introducing his friend the owner of Johnson&Johnson pharmaceutical at his rally and touting the success of the WARP SPEED VACCINES and endorsing Dr Oz at his rally is (proof) Trump is one of them… Trump plays the Good Cop Bad Cop blaming Democrats all the time to the American people just like that old fagLarper Chuck Grassley always does and never gets any result.

Just remember that Trump endorsed or hired all the key people that screwed the American people in 2020 and shoved Biden down our throats…. Trump kiss my PATRIOT ass.

If you are one of the original anons you can name them all.

Barr

Milley

Wray

McConnell'

Kemp

Ducey

Pence

Amy Coney Barrett

Brett Kavanaugh

The list is really long and I can name a lot of so-called republicans that were involved in stealing the 2020 election across America and Trump either hired them or endorsed all of them….. Of course Trump could be extremely stupid and not know they were all traitors but he's not that dumb.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

784d35  No.16247345

>>16247337

That is the most likely reason anon. But, endorsing her would make her viable I think. Very viable. I'm not sold on Oz or the other fuck but it matters not to me. I don't dwell there.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

1f4106  No.16247346

File: b72115aa692e053⋯.gif (813.8 KB, 245x200, 49:40, comeon.gif)

>>16247338

meme speaks for itself, no?

you picking rulers? people who KNOW and run the global human livestock plantation, or are you acting to expose that?

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

e83c83  No.16247347

File: 749274dc917c7f8⋯.jpg (20.01 KB, 300x455, 60:91, BT.jpg)

>>16247242

Morning Swordy!

2474

God Bless you as well and keep you and all anons from harm, this day and forever!

o()xxxx({:::::::::::::::::::>

o7

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

e83c83  No.16247348

TODAY'S FORECAST

⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⣀⣠⣤⣤⣶⣶⣶⣶⣶⣶⣶⣶⣶⣦⣤⣤⣀⡀

⠀⠀⠀⠀⠀⠀⠀⣀⣴⣾⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣶⣤⣀

⠀⠀⠀⠀⢀⣠⣾⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣦⣀

⠀⠀⣠⣶⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣷⡀

⢀⣾⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣆

⣾⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣦

⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿

⣿⣿⣿⠛⠻⢿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⡿⠿⠛⢿⣿⣿

⢻⣿⣿⠀⠀⠀⠀⠉⠛⠻⢿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⠿⠛⠉⠁⠀⠀⠀⣼⣿⡿

⢸⣿⣿⣇⠀⠀⠀⠀⠀⠀⠀⠈⠙⠻⢿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⡿⠿⠛⠉⠀⠀⠀⠀⠀⠀⠀⢠⣿⣿⠇

⠀⠻⣿⣿⣦⣄⣀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠉⢙⣻⣿⣿⣟⡛⠉⠁⠀⠀⠀⠀⠀⠀⠀⠀⢀⣀⣴⣿⣿⡿

⠀⠀⠙⢿⣿⣿⣿⣿⣿⣿⣶⣶⣶⣶⣶⣶⣿⣿⡟⠁⡏⠛⣿⣿⣷⣶⣶⣶⣶⣶⣾⣿⣿⣿⣿⣿⣿⣿⠃

⠀⠀⣴⣾⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⠛⠀⣠⣧⡀⠙⢿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⡀

⠀⠀⣾⣿⣿⣿⣿⣿⡿⠟⠛⠉⠉⣿⣿⣿⣿⣧⣰⣿⣿⣷⣠⣿⣿⣿⣿⣿⡟⠛⠉⠉⠉⠻⣿⣿⣿⡿⠃

⠀⠀⠈⠻⣿⠟⠻⢥⡤⠄⠀⠀⠠⣽⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⣿⡟⠀⠀⠀⠀⠾⠿⠟⠋

⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀ ⢻⣿⣿⡍⣿⣿⣿⠉⣿⣿⡏⣵⣿⣿⡿⠃

⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀ ⢸⣿⣿⡇⣿⣿⣿⠀⣿⣿⡇⣿⣿⣿

⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀ ⠘⣿⣿⡇⣿⣿⣿⠀⣿⣿⡇⣿⣿⣿

⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀ ⣿⣿⡇⣿⣿⣿⠀⣿⣿⠁⣿⣿⣿

⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀ ⣿⣿⡇⢹⣿⣿⢰⣿⣿⠀⣿⣿⡟

⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀ ⣿⣿⡇⢸⣿⡿⢸⣿⣿⠀⣿⣿⡇

⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀⠀ ⠙⠛⠃⠸⠿⠇⠸⠿⠿⠀⠿⠟⠃

WHERE'S THE ARK DAVEY

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

2d83e4  No.16247349

>>16247342

>nearly always sterile

Fertile mules? I thought it was a consequence of chromosomes that they couldn't be viable.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

2d83e4  No.16247350

File: e73f1e849afdf7e⋯.jpg (149.48 KB, 1100x653, 1100:653, soy.jpg)

what's the source for this pic

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

e0487e  No.16247351

File: 99b4fb2ba806f60⋯.png (53.41 KB, 659x405, 659:405, ClipboardImage.png)

True, they won't suddenly lactate. But telling them to "google" or "ask Siri" How to make your own baby formula might help solve some panic-stricken mothers a little stress.

/shrug

https://twitter.com/MCAmselem/status/1524013221379772420

Breastfeeding mom here 🙋🏼‍♀️ a couple things:

1. Formula shortage is a very big deal

2. There are plenty of legitimate reasons why women don’t breastfeed

3. Saying “just breastfeed” to moms will not suddenly cause them to lactate

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

eeabdc  No.16247352

>>16247326

I still wonder about the people who did this. They looked just like normal dudes and women.

Why would someone do something that legally dangerous for some votes? It's insane.

Perhaps these people aren't just normal people. No financial gain from it, only ideological. Extremely risky.

Who were these people?

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

54c3ec  No.16247353

File: 771d0ca5e770529⋯.gif (471.83 KB, 500x376, 125:94, 771d0ca5e7705297de69f7403c….gif)

>>16247344

delete this

/sarc

chekked, for uncomfortable truths.

I don't agree with everything you're saying, but I do agree with a lot of it.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

54d19b  No.16247354

>>16247326

>>16247235

Step 1: Show people that there was blatant election fraud.

Step 2: Show people that MSM will deny it and try to say you are crazy.

Step 3: Show people that the Justice System will do nothing about it.

Step 4: Campaign like crazy and tell people to keep voting in rigged elections.

Step 5: Show people that there was blatant election fraud again.

Step 6: Show people that MSM will deny it and try to say you are crazy.

Step 7: Show people that the Justice System will do nothing about it.

Step 8: Campaign like crazy and tell people to keep voting in rigged elections.

Step 9: Show people that there was blatant election fraud again.

Step 10: Show people that MSM will deny it and try to say you are crazy.

Step 11: Show people that the Justice System will do nothing about it.

Step 12: Campaign like crazy and tell people to keep voting in rigged elections.

Rinse & Repeat

Rinse & Repeat

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

2d83e4  No.16247356

File: f6a2de9f6ee3794⋯.png (838.6 KB, 1118x930, 559:465, biolabsukr.png)

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

e83c83  No.16247357

File: 88bdd7312d97e32⋯.png (104.25 KB, 405x504, 45:56, 98bce1a124d694cfb1c52f5321….png)

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

241014  No.16247359

File: 9f57ae991400884⋯.jpeg (41.65 KB, 640x480, 4:3, 14F287FA_6CFC_4DF3_B3BC_4….jpeg)

5 Radical Facts About Incoming White House Press Secretary Karine

Jean-Pierre

Karine Jean-Pierre was named the new White House press secretary on Thursday, taking over from Jen Psaki, who is departing for MSNBC on May 13.

Jean-Pierre’s appointment was hailed as “historic,” since she will be the first black woman and “out” LGBTQ person to serve in the role. However, there are several facts about Jean-Pierre’s record of radical politics that might prove to be more important than her skin color or her sexual preference. Here are five facts:

1. Jean-Pierre worked for radical organization MoveOn.org. MoveOn.org, launched in the late 1990s to oppose the impeachment of President Bill Clinton, pushed, ironically, for the impeachment of President Donald Trump, abandoning its former principles. The group also infamously accused General David Petraeus, then commanding U.S. forces during the Iraq War, of betraying the country. Jean-Pierre worked for MoveOn.org from 2016 until the 2020 presidential campaign.

2. Jean–Pierre has a history of anti-Israel radicalism. In 2019, Jean-Pierre applauded Democratic presidential candidates for boycotting the annual American Israel Public Affairs Committee policy conference in Washington, DC, a prominent pro-Israel gathering. “You cannot call yourself a progressive while continuing to associate yourself with an organization like AIPAC that has often been the antithesis of what it means to be progressive,” Jean-Pierre wrote.

3. Jean-Pierre once said that no one who has been merely accused of sexual misconduct should seek public office. Jean-Pierre told Jake Tapper on CNN’s State of the Union in 2017 that even if there was no corroborating evidence, and nothing had been proven against the accused, the mere existence of the accusation should be disqualifying. Ironically, she went on to work for Biden, even after he had been credibly accused of sexual misconduct by former aide Tara Reade.

4. Jean-Pierre is married to CNN anchor and correspondent Suzanne Malveaux. Jean-Pierre is only the latest example in a pattern of high-level personal ties and romantic links between Democrats and the media, as documented by Breitbart News editor-in-chief Alex Marlow in his 2021 blockbuster Breaking the News: Exposing the Establishment Media’s Hidden Deals and Secret Corruption. CNN will continue to be, in effect, the Biden administration’s communications shop.

5. Jean-Pierre stoked racial divisions and fears when Donald Trump took office. She told Bill Maher on HBO’s Real Time, “I think the thing to understand is that, if you are not white, male, straight, you are — you fear a — Donald Trump’s presidency because there is no place for you in a Donald Trump’s presidency.” She later claimed that Trump wanted to put a “whites only” sign on the Statue of Liberty, and claimed Trump had been a lifelong racist, despite evidence to the contrary.

https://www.breitbart.com/politics/2022/05/05/five-radical-facts-about-incoming-press-secretary-karine-jean-pierre/

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

ab6662  No.16247360

>>16247356

A few is like 3 or 4, not 30 or 40.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

e21051  No.16247361

File: 48187a5354c6bd7⋯.jpg (646.69 KB, 1080x2280, 9:19, Screenshot_20220510_081714….jpg)

https://www.nationalreview.com/2022/05/judge-gives-ample-leeway-to-prove-sussmann-lied-to-fbi-but-limits-durhams-joint-venture-evidence/

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

7c5d0c  No.16247362

>>16247227

it has been a turbulent week. Guess it has to happen sometime.

Didn't know my stress levels could be so high. I am feeling like an unwound goofball. Imagine hanging out with the romans back then. I can.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

0eb0fa  No.16247363

they believe they can breed a better human.

like you can breed cattle, like you can breed an ear of corn.

their goal is a master slave race through eugenics and manipulation of genetics

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

54d19b  No.16247364

>>16247341

The Freemasons are just puppet foot soldiers.

Who is their commander? Who is pulling their strings.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

2d83e4  No.16247365

File: f0a845bbeb8de3c⋯.png (813.84 KB, 899x568, 899:568, ClipboardImage.png)

>>16247356

english.scio.gov.cn/beltandroad/2020-07/08/content_76248902.htm

First container train from China's Wuhan arrives in Kiev

The first direct container train, which left the central Chinese city of Wuhan on June 16, arrived in Kiev on Monday, opening up new opportunities for China-Ukraine cooperation, said Ukrainian officials.

The first direct container train, which left the central Chinese city of Wuhan on June 16, arrived in Kiev on Monday, opening up new opportunities for China-Ukraine cooperation, said Ukrainian officials.

"Today's event has important symbolic significance for Sino-Ukrainian relations. It means that future cooperation between China and Ukraine within the framework of the Belt and Road Initiative will become even closer," said Chinese Ambassador to Ukraine Fan Xianrong during a ceremony to mark the train arrival here.

"Ukraine will show its advantages as a logistics center connecting Europe and Asia, and Sino-Ukrainian economic and trade cooperation will become even faster and more convenient. All this will bring even more benefits to the peoples of the two countries," he said.

Ukraine's Infrastructure Minister Vladyslav Kryklii, who also attended the ceremony, said this is the first step of regular container transportation from China to Ukraine.

"This is the first time that Ukraine has not just been used as a transit platform for container transportation from China to Europe, but acted as the final destination," said Kryklii.

Ivan Yuryk, acting head of Ukrainian Railways, told Xinhua that his country plans to expand the route of the container train.

"We have big expectations as to this container route. We can receive (trains) not only in Kiev but also in Kharkiv, Odessa and other cities," said Yuryk.

"For now, we've made plans with our partners about one train per week. It's a reasonable volume for a start," said Oleksandr Polishchuk, first deputy head of Liski, a branch company of Ukrainian Railways that specializes in intermodal transportation.

"One time per week allows us to improve the technology, work out necessary procedures with customs and controlling authorities, as well as with our clients," Polishchuk said.

The official added that one train can transport up to 40-45 containers, which adds up to a total of 160 containers per month. Thus Ukraine will receive up to 1,000 containers till the end of this year.

"In 2019, China became Ukraine's most important trading partner," said Ukrainian economist Olga Drobotyuk in a recent interview with Xinhua. "The launch of such trains can help to further expand and strengthen trade, economic, political and cultural cooperation between the two countries."

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

2d83e4  No.16247366

File: b4a6ae335c35a2d⋯.png (805.09 KB, 899x599, 899:599, ClipboardImage.png)

>>16247365

>The first direct container train, which left the central Chinese city of Wuhan on June 16, 2020, arrived in Kiev on Monday, opening up new opportunities for China-Ukraine cooperation, said Ukrainian officials.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

13884c  No.16247367

File: 74b62c08301890b⋯.jpg (82.23 KB, 848x500, 212:125, 6dwdvd.jpg)

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

7c5d0c  No.16247368

>>16247355

good morning. i see you've posted right on schedule.

Get me rolling.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

7c5d0c  No.16247369

>>16247367

so very very wrong.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

784d35  No.16247370

>>16247344

Yea, does make me wonder. A lot.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

f167db  No.16247371

>1 hour mark passed and not even 150 posts yet at that point

>Swordy Shift no longer the fastest post Q world shift anymore.

The Bible Battle Anons are to blame.

They're noticeably MIA lately.

I guess they finally raptured.

Good for them!

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

ec4e7e  No.16247372

>>16247351

It is hard to lactate when the glands are full of silicone.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

5a293d  No.16247373

File: 2789450cd77f50a⋯.jpg (484.06 KB, 1406x1890, 703:945, barrffail.jpg)

File: 9438ec27f52f535⋯.mp4 (870.69 KB, 488x270, 244:135, barryonjoe2f.mp4)

>>16246495 pb

Fuck You, famefag Barr

weak POS

BARR + Y == BARRY

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

54d19b  No.16247374

>>16247352

They were definitely paid.

Do you think "campaign contributions" are used to print fliers? They are used to bribe election officials and cops and judges, etc.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

241014  No.16247375

File: a74fc5960f635cd⋯.jpeg (54.96 KB, 640x480, 4:3, A452F1ED_B0A5_49F5_8BB8_3….jpeg)

File: 29b509f6be42d4d⋯.jpeg (91.98 KB, 1024x683, 1024:683, F9185473_D94A_4EE2_805E_7….jpeg)

Karine Jean-Pierre: ‘If You’re Not White, Male, Straight, or Wealthy There Is a Target on Your Back’

President Joe Biden’s new press secretary Karine Jean-Pierre has a history of calling out America’s racism throughout her career in politics and activism.

“I just think that America has a really big problem with race. And it’s very real and we have yet to deal with it,” he said in a PBS interview with Bonnie Erbé in 2019.

After former President Donald Trump won in 2016, Jean-Pierre wrote her memoirs and spoke about the problems of racism in America during her book tour.

“I always say, if you’re not white, male, straight, or wealthy you’re under attack, I mean there is a target on your back,” she said.

Before working for Biden. Jean-Pierre embraced the more activist side of politics by taking a job at Moveon.org after a history of working with some of America’s most famous Democrats.

She worked for scandal-ridden political figures such as Sen. John Edward and Rep. Anthony Weiner as well as Democrat champions like President Barack Obama. The daughter of Haitian immigrants, Jean-Pierre was raised in New York City and is currently living in the Washington, DC, area in a domestic partnership with CNN’s Suzanne Malveaux.

But she said she still experienced racism despite working in America’s most liberal cities.

“I think when you are a person of color when you are a black woman, you experience it every day,” she said after Erbé asked her about experiencing racial prejudice in America. “It’s as simple as walking into a store and people look at you and wonder do you belong in the store.”

“It happens every, every day,” she added.

She said she did not want to blame Trump for racism, noting it had existed in the country for a long time, but said Americans appeared more comfortable about being openly racist.

“What he has done is he has made it blatantly, people are just overt about it in a way that we have never seen before,” she said.

She spoke of Republicans running for office after Trump who she said were openly racist.

“We saw candidates in this last election, who were proud to be white supremacist, white nationalist, talking about purging, and we need a white power, white America,” she said.

“I mean this is what we were hearing from some of the candidates and they were in the Republican Party.”

She noted the Republican Party denounced those candidates but indicated that it was Trump who made them more comfortable.

“We saw them across the country and we had never seen that before or hadn’t seen it in a very long time,” she said, comparing it to the “Jim Crow era” of the past.

During a book event with MSNBC’s Joy-Ann Reid, Jean-Pierre urged an old white male asking about how to get involved to join Moveon.org and “become an ally” for minorities.

She asked him to read the book “How to Be an Anti-Racist,” by Ibram X. Kendi a book that argues the existence of “systemic racism” in America and demands people to do more about it than not just “not be racist.”

“We need more people like you who look like you to really get into it with us,” Jean-Pierre said to the man.

She thanked him for coming to her book event, noting it was evident that he wanted to get involved.

“I think there is a question of how to get more people to come in who are not a person of color, right? Who’s not a woman right?” she asked.

She called out the current political climate and “all these horrible ‘isms” that Trump had appealed to during the 2016 election.

“Racism, bigotry, homophobia, xenophobia, misogyny that existed way before Trump got here, and that is something we just have to continue to remember,” Jean-Pierre said. “He touched on something that was there, that was very painful and gave it a whole new life in a very public way.”

She urged everyone at the event to get involved with the 2020 election, warning that if Trump was re-elected it would be the end of the country.

“This is a five-alarm right here. If we don’t do this now and today and the next 12 months, that’s it,” Jean-Pierre said. “I really do believe that’s it.”

https://www.breitbart.com/politics/2022/05/09/karine-jean-pierre-if-youre-not-white-male-straight-or-wealthy-there-is-a-target-on-your-back/

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

13884c  No.16247376

File: da190c8fb47a44e⋯.jpg (62.39 KB, 640x480, 4:3, 6fj93m.jpg)

>>16247359

Negroid Obama's deterioration of America continues.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

e2f9c3  No.16247377

File: a33e87f275be2f2⋯.png (2.59 MB, 1642x1430, 821:715, Screen_Shot_2022_05_10_at_….png)

>>16247179

ty bake!

HUNTER BIDEN OIL RIG???

https://www.thegatewaypundit.com/2022/05/ukraine-abandoning-military-units/

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

8cb4ba  No.16247378

File: f0f9431da091bb8⋯.png (1.16 MB, 944x636, 236:159, ClipboardImage.png)

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

784d35  No.16247379

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

778aae  No.16247380

File: 18641316d9d7eb6⋯.png (99.55 KB, 1751x852, 1751:852, ClipboardImage.png)

"A lot of the divide comes from the notion that people are divided, and leaders will exploit divisions and religious differences to try and keep people divided to cause conflict to maintain power for themselves in an ideological way" - JK

🧐

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

ab6662  No.16247381

>>16247365

Shipping the COVID back to its source? I'd be careful opening that Tojan horse.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

d181a9  No.16247383

File: a8c56ebba542c7f⋯.png (422.07 KB, 800x533, 800:533, 5b89096673fa016598c3a2dfaf….png)

>>16247332

mornin flightmaster

howza

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

d15616  No.16247384

>>16247352

it was trump haters.

liberal population was primed by trump hate

probably doing it for years and never got caught?

figured they'd never lose

stupid

never realized what the penalties were

'everybody's doing it'

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

6e3f7f  No.16247385

File: eca80a66e23a53d⋯.jpeg (280.36 KB, 1440x1857, 480:619, 18FBF634_45D1_49ED_895D_8….jpeg)

https://storage.courtlistener.com/recap/gov.uscourts.dcd.235638/gov.uscourts.dcd.235638.126.0.pdf

Case 1:21-cr-00582-CRC Document 126 Filed 05/09/22 Page 1 of 1

IN THE UNITED STATES DISTRICT COURT

FOR THE DISTRICT OF COLUMBIA

UNITED STATES OF AMERICA,

v. Case No. 1:21-cr-00582

MICHAEL A. SUSSMANN,

Defendant.

JOINT PROPOSED VERDICT FORM

As to COUNT ONE, charging Making a False Statement on or about September 19, 2016,

we the jury unanimously find Michael A. Sussmann:

Not Guilty: __ Guilty: __

DATE: _ FOREPERSON: _______

1

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

ab6662  No.16247386

File: 8541e567f3ce8b3⋯.png (359.89 KB, 417x435, 139:145, R_U_A_WIZARD.png)

>>16247373

>BARR + Y == BARRY

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

f74b04  No.16247387

File: aaf3bc2ab56bcba⋯.png (349.71 KB, 1007x657, 1007:657, supermanmovie.png)

File: 674168707301a34⋯.jpg (114.67 KB, 2560x1371, 2560:1371, photo_2022_05_08_14_52_55.jpg)

File: a8517137a622025⋯.jpg (65.53 KB, 534x667, 534:667, anubisstatuemet.jpg)

File: 21b7bdf3f08715c⋯.jpg (815.44 KB, 2487x3557, 2487:3557, studiesineastchr12free_004….jpg)

File: 26762fe3fc693a7⋯.jpg (296.38 KB, 1244x1779, 1244:1779, studiesineastchr12free_003….jpg)

¨anubis is the 'anti-christ' the 'khrist of the inbred' or 'the least inbred' of the (((inbreds))), a jackal ~ (((jakob))) and can only learn that as it is a product of (((inbreeding))) it should never exist as how the (((inbred))) judas was made to hang by Jesus God.

(((inbreeding))) = child rape = endless death = godless creature to be drowned.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

587038  No.16247388

File: ba69b979094aefd⋯.jpg (145.2 KB, 658x700, 47:50, downloadfile_6.jpg)

>>16247383

Be respectful on Q Research.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

784d35  No.16247389

>>16247375

And yet, there she is. Right at the top of the seat of power. Funny how you can be so oppressed in those circles and rise to the top. Fuck her. She's the spit'n image of the propagandist she is replacing. Subvert.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

2d83e4  No.16247390

According to the statements of the Kyiv authorities, there are about 1,000 military personnel at Azovstal, of which several hundred are wounded.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

e2f9c3  No.16247391

>>16247211

Now would not be the time to turn away from God anon. Yes, Christianity has the wrong story, kinda. Christ has been here several times. We will eventually get our TRUE history and that will help us alot.

God expresses through NATURE. Nature is one of our connects to God.

Did anons know there is a whole stanza to the Lords Prayer we do not ever hear or see?

Our MOTHER who are in Heaven, Hallowed be the name…

So ALOT coming for us all as we rediscover our true Nature, our relationship to God and to this planet…

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

d15616  No.16247392

>>16247352

also, for money

people who fail to care about politics.

thought it 'didn't matter'

same people who say ' i wont vote cause it doesnt matter'

this of all the nurses and doctors who gave the clot shot KNOWINTLY.. they look normal too, don't they.

Everyone thought of this after the end of WW2, since they all commented "Wow those people all looked normal. How could they do that stuff"

Famous line "Banality of Evil"

A lot of trees been killed with people trying to explain it. (paper and ink)

kekkekk

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

45b0ac  No.16247393

>>16247351

You should take your great wisdom on over to Reddit.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

54d19b  No.16247394

>>16247379

They take direct orders from Satan?

I believe there are some flesh & blood individuals who are responsible.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

2d83e4  No.16247395

YouTube embed. Click thumbnail to play.

Kraz of the Armed Forces of Ukraine, packed with soldiers destroyed by ATGM

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

b0af5d  No.16247396

Momentum !

2000 mules continues to spread like corona

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

d181a9  No.16247397

File: c3ca1781c145f38⋯.png (182.04 KB, 404x347, 404:347, 82a35a9b207e0c5b7922392fd4….png)

File: 5cbb9b61d75cebe⋯.png (567.78 KB, 768x434, 384:217, 384c37ad8e3509f1766ad6c3c1….png)

>>16247388

sho thang

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

d15616  No.16247398

>>16247352

or think of what Soros said when asked about how he turned in Jews, confiscated their property and sent them off in trains to the work camps

"I have no guilt about it. If I didn't do it, someone else would have"

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

8fa33e  No.16247399

File: 594100bc32db9b3⋯.jpg (62.91 KB, 253x204, 253:204, dafuqPepe.JPG)

>>16247396

>spread like corona

Soooo… not at all?

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

67ecc2  No.16247400

>>16247375

groomin in ecstasy

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

784d35  No.16247401

>>16247385

Okay, guilty. Now go home and stay there for a bit. After your probation you can get your gig at CNN, MSDNC for 7 figures. Sorry for the inconvenience. We had to make it look like we were doing something.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

241014  No.16247402

File: 2194b6e4df07506⋯.jpeg (72.06 KB, 640x480, 4:3, E7F147E3_E5A6_4DD8_8325_F….jpeg)

BLM Co-Founder Admits She Used Group’s $6 Million Property to Host Personal Parties

Hannah Bleau9 May 2022

Black Lives Matter (BLM) co-founder Patrisse Cullors admitted this week that she used the group’s $6 million property to host personal parties, igniting further suspicions of BLM leaders misusing funds for personal gain.

Cullors made the admission in an interview with the AP, in which she denied overt wrongdoing when it came to the mountain of funds the group received after the George Floyd protests in 2020. While she admitted that the group was ill-prepared to handle the wave of funds, leaders ultimately purchased a $6 million compound in Los Angles, which has continued to spark criticism:

Recent disclosures that the foundation had paid $6 million for a Los Angeles compound in 2020 unleashed a torrent of criticism and social media chatter. The property in Studio City — including a home with six bedrooms and bathrooms, a swimming pool, a soundstage and office space — is meant to be both a meeting venue and a campus for Black artists.

Some criticism came from BLM supporters like Justin Hansford, director of the Thurgood Marshall Civil Rights Center at Howard University. He said the property purchase could be weaponized by movement opponents, leading possible donors to shy away from Black-led social justice organizations: “That’s the thing that you don’t want to get out of hand.”

We really wanted to make sure that the global network foundation had an asset that wasn’t just financial resources,” (this is the most insane statement I’ve ever heard to justify theft) Cullors told the AP, defending the purchase. “And we understood that not many black-led organizations have property. They don’t own their property.”

However, while denying any general financial malfeasance, Cullors admitted to using the 6-bedroom home twice for personal use, acknowledging that it “probably wasn’t the best idea.”

One of those events took place in January 2021, where she apparently sought “refuge at the property amid threats on her life.” However, at that time, she chose to host an inauguration party celebrating the election of Joe Biden and Kamala Harris, along with roughly 15 people, “including BLM Los Angeles chapter members and other prominent movement supporters,” according to the AP.

Two months later, Cullors threw her son a birthday party at the BLM property, but she told the outlet “she intended to pay a rental fee to the foundation.”

“I look back at that and think, that probably wasn’t the best idea,” she said.

However, she maintained that, as a whole, she did not misuse BLM funds.

“The idea that (the foundation) received millions of dollars and then I hid those dollars in my bank account is absolutely false,” she told the outlet

That’s a false narrative. It’s impacted me personally and professionally, that people would accuse me of stealing from black people,” she added.

https://www.breitbart.com/politics/2022/05/09/blm-co-founder-admits-she-used-groups-6-million-property-host-personal-parties/

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

d15616  No.16247403

>>16247332

shadowing joe?

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

e2f9c3  No.16247404

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

587038  No.16247405

>>16247389

>>16247389

She's a Hussein disciple and a lowlife GARBAGE DISPOSAL.

>>16247397

>>16247397

Lmao…good one o7.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

54d19b  No.16247406

>>16247375

So much racial prejudice that she has a 6 figure salary.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

e0f89c  No.16247407

>>16247360

scott ritter said 26 biolabs which is ridiculous in his opinion.

i want to see what was going on at Snake Island.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

e0487e  No.16247408

>>16247393

If they can find reddit, they can enjoy the hapless void of redditors who are in desperate need to vent their concerns over how to ceaselessly complain about what to do about <current crisis> while their baby suffers from not being poisoned by Enfamil products.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

b695f5  No.16247409

>>16247236

CP Reported

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

ffeb42  No.16247411

File: 3bfb061f23748f7⋯.jpeg (116.43 KB, 750x1334, 375:667, 5F70910F_8A7A_4B69_A1D8_D….jpeg)

>>16247242

God Bless all anons and Swordy!

Some anons are revolted my God’s mention.

They take it out though on SwordAnon which isn’t fair. We know who/what they are, the detractors, haters, shills and atheists!

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

252f8d  No.16247412

At the risk of being labeled shareblue or shill, anons here are the smartest people I know. I haven't been here much since Biden came in. I was following this since the halfchan days. I still lurk but can say something has felt off with how things are playing out to me.

I saw Trump bring these J&J faggots on stage the other day and I can't understand why he would do that. He looks like he's owned by corporate America. He's continued to push the vaccine and even got the booster after calling it a money making scam. Why? Does anyone have a theory regarding this? There's actually quite a bit I question about him now that the dust has settled on his Presidency. And please remember, before you just dismiss me and give me some angry response because I'm saying something you don't like or agree with, Q said we need to ask questions. Trusting people blindly is how all these world leaders got into power. Trust is earned. Trust needs to be an ever going process never to be settled on. Anyone can become corrupt at any time. Question everything. With that being said. I'll await being called Mossad but hope I can get a few decent replies.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

ab6662  No.16247413

>>16247409

Bleachbit or CCCleaner

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

54c3ec  No.16247414

>>16247352

>I still wonder about the people who did this. >They looked just like normal dudes and women.

>Why would someone do something that legally dangerous for some votes?

9/10 when criminals are caught, it isn't their first time vomiting the crime, it's just their first time being caught.

Ekctuib fraud has been going in democrat counties l in Georgia (and other states) for a long time. See:

>Former Dodge County Sheriff and Deputy Plead Guilty to 2004 Election Fraud

https://archives.fbi.gov/archives/atlanta/press-releases/2010/at031210b.htm

you're not witnessing their first rodeo here

this is institutionalized theft.

to them, it's just something they do every November, Trump or no Trump, they steal elections

That's why they did it. They ALWAYS do it.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

54d19b  No.16247415

>>16247375

>“It’s as simple as walking into a store and people look at you and wonder do you belong in the store.”

Maybe she should use her position to tell nignogs to stop the smash & grabs so that people of color are not looked at suspiciously when they go into stores.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

21eb2a  No.16247416

File: 110c6b906a38b96⋯.png (44.19 KB, 1225x353, 1225:353, ClipboardImage.png)

https://www.msn.com/en-us/tv/news/watch-oan-airs-30-second-acknowledgment-that-two-georgia-election-workers-did-not-commit-fraud-after-settling-lawsuit-against-them/ar-AAX6NOj?ocid=msedgntp&cvid

One America News network (OAN) aired a 30-second acknowledgment Monday that two election workers in Georgia did not commit fraud in 2020. This on-air admission came a few weeks after settling a lawsuit filed against them by the two workers.

The AP reported the settlement on April 22. Fulton County election workers Ruby Freeman and Wandrea “Shaye” Moss had sued OAN, its owners, and chief White House correspondent Chanel Rion for making debunked claims that they introduced suitcases of illegal ballots at the State Farm Arena — among other acts of fraud — in an effort to rig the 2020 presidential election. The AP reports that the parties “agreed upon and signed a binding set of settlement terms” which were undisclosed.

Less than three weeks later, OAN aired a segment clearing their names. The acknowledgment came shortly after 7 p.m. and was replayed during the 11 p.m. broadcast. Anchor Mike Dinow set up the admission by saying “we now provide you with this updated report from Georgia officials.”

An unidentified narrator then said:

“Georgia officials have concluded that there was no widespread voter fraud by election workers who counted ballots at the State Farm Arena in November 2020. The results of this investigation indicate that Ruby Freeman and Wandrea ‘Shaye’ Moss did not engage in ballot fraud or criminal misconduct while working at State Farm Arena on election night. A legal matter with this network and the two election workers has been resolved to the mutual satisfaction of the parties through a fair and reasonable settlement.”

Freeman and Moss have also sued Rudy Giuliani and The Gateway Pundit for pushing the debunked claims. Those cases are ongoing.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

241014  No.16247417

File: 90d65e0cba5378c⋯.jpeg (122.4 KB, 1201x712, 1201:712, 7F567495_8F03_4AB9_96B7_C….jpeg)

(Undertaker, Cript Keeper) Lightfoot: $500,000 in Funding for Abortions for Non-Chicagoans Is ‘a Down Payment

Ian Hanchett9 May 2022

1:28

On Monday’s broadcast of MSNBC’s “Hallie Jackson Reports,” Chicago Mayor Lori Lightfoot (D) said that the $500,000 the city is allocating for people seeking abortions in Chicago from neighboring states “is simply a down payment” and “a start, and not an ending.”

Lightfoot said, “$500,000 is simply a down payment to help our frontline providers get over this immediate hurdle. But they tell us they’ve already seen an exponential increase in the amount of calls to helplines from out of state, just from what’s happened in Texas. And over the last week, there’s a lot of panic and fear, because too many women believe that Roe has already been overturned and that their right to access to reproductive care has already been extinguished. And if you look around Chicago, we’ve got a number of states that have the so-called trigger laws that would ban abortion upon the reversal of Roe. So, we’ve seen a substantial increase already, and we’re expecting, frankly, an explosion of new cases from women in Wisconsin, Missouri, potentially Michigan, Indiana. I think the list is long, and Chicago is going to be an oasis in the midwest and we’ve got to be ready. So, this is a start, and not an ending.”

https://www.breitbart.com/clips/2022/05/09/lightfoot-500000-in-funding-for-abortions-for-non-chicagoans-is-a-down-payment/

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

cace9d  No.16247418

File: 153e1b0bb52938b⋯.png (286.69 KB, 501x411, 167:137, ClipboardImage.png)

>>16247211

shoo, be gone

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

a696ea  No.16247419

File: 6162809e3c5beaa⋯.jpg (112.57 KB, 887x500, 887:500, 6162809e3c5beaa3e69967d652….jpg)

File: 4ab2ff4096d1057⋯.jpg (62.03 KB, 500x590, 50:59, 4ab2ff4096d105716468780148….jpg)

>>16247402

>>16247402

>>16247402

BLM black women are raunchy ghetto cum dumpsters…. Putrid cesspools.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

2f0c14  No.16247420

File: 311d6e9532de679⋯.png (627.86 KB, 527x757, 527:757, Christianart2.png)

File: 0799f891355f919⋯.png (60.99 KB, 287x381, 287:381, untitled.png)

File: 147162fefbcd160⋯.png (1.24 MB, 946x768, 473:384, HouseofGermanArt.PNG)

File: 6ae0b0a81695577⋯.jpeg (619.09 KB, 700x891, 700:891, a1ba757605cc764e.jpeg)

File: 3fd1073e0a76534⋯.jpg (464.64 KB, 1296x1967, 1296:1967, diechristlicheku07deut_039….jpg)

https://archive.org/search.php?query=creator%3A%22Deutsche+Gesellschaft+f%C3%83%C2%BCr+Christliche+Kunst%22

https://archive.org/search.php?query=title%3A%28%2Agypt%29%20AND%20date%3A%5B1830-01-01%20TO%201945-01-31%5D

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

85bc47  No.16247421

>>16247331

he also shilled the vaccine for his big pharma masters

Trump is not your savior

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

54c3ec  No.16247422

>>16247417

Instead of spending 500,000 on killing babies, why not spend 500,000 on supporting babies and women?

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

f6284f  No.16247423

File: f59ef3f7cfbd71f⋯.jpg (Spoiler Image, 140.49 KB, 750x728, 375:364, 1651329445275.jpg)

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

b0af5d  No.16247424

File: be9d191ec081505⋯.jpg (391.12 KB, 2880x2880, 1:1, 20220510_093449.jpg)

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

411199  No.16247425

File: 82b3d0b7815dd87⋯.jpg (63.48 KB, 667x500, 667:500, 61muck.jpg)

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

784d35  No.16247426

>>16247402

>Two months later, Cullors threw her son a birthday party at the BLM property, but she told the outlet “she intended to pay a rental fee to the foundation.”

Yea, pays it out of the same funds she bought the house with. She has the tacit approval of Garland. He's too busy looking at Moms and Dads. You know, those dire extremist threats to western democracy.

Enough to make a fucking Skunk vomit.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

a696ea  No.16247427

File: a0cd0d24fc4bf14⋯.jpg (60 KB, 517x463, 517:463, tyvh.jpg)

File: a0cd0d24fc4bf14⋯.jpg (60 KB, 517x463, 517:463, tyvh.jpg)

File: a0cd0d24fc4bf14⋯.jpg (60 KB, 517x463, 517:463, tyvh.jpg)

File: a0cd0d24fc4bf14⋯.jpg (60 KB, 517x463, 517:463, tyvh.jpg)

File: a0cd0d24fc4bf14⋯.jpg (60 KB, 517x463, 517:463, tyvh.jpg)

Real deal MAGA white people just want to be around other attractive white people.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

39df43  No.16247428

File: 4948d75c2a6e67e⋯.png (40.7 KB, 262x361, 262:361, ClipboardImage.png)

… but i still haven’t found where the streets have no name.”

keep searching bono… look inside!

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

241014  No.16247429

File: bda2bf8a790c9ea⋯.jpeg (340.63 KB, 1240x697, 1240:697, D230F63F_B841_4392_A729_B….jpeg)

10 May, 2022 12:04

NATO state labels Russia ‘supporter of terrorism’

Lithuania has called for the world to investigate Russia’s actions in Ukraine

Lithuania’s parliament, the Seimas, unanimously passed a resolution on Tuesday accusing Russia of genocide and terrorism in Ukraine.

The “large-scale armed aggression” launched by Russia against Ukraine on February 24 amounts to “genocide of the Ukrainian people,” the document said.

“The Russian Federation, whose military forces deliberately and systematically bomb civilian targets, is a state that supports and practices terrorism.”

The Seimas called on the international community to set up a special tribunal to investigate the behavior of Russian troops in Ukraine. The vote on the resolution took place shortly after Elena Kondratyuk, the deputy speaker of Ukraine’s parliament, addressed Lithuanian MPs.

Kiev, Western governments, and human rights groups have accused Russian troops of committing war crimes in Bucha and other cities in Ukraine. Moscow has repeatedly denied that its forces were killing civilians and argued that Ukraine and the West are waging a disinformation campaign.

Russia, in turn, has accused Kiev of shelling residential areas in Donbass and executing prisoners, which Ukraine has also denied. Both countries have accused each other of genocide.

Michelle Bachelet, the UN’s top human rights official, condemned Russia’s actions in Ukraine in April. Her spokesperson, Ravina Shamdasani, however, told reporters the same month that the office of the High Commissioner for Human Rights had not documented crimes in Ukraine that could be qualified as genocide.

https://www.rt.com/russia/555241-lithuania-resolution-russia-genocide/

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

ab6662  No.16247430

>>16247417

Considering who is actually most likely to "babort babby" is could be considered future crime prevention.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

e0487e  No.16247431

>>16247401

You think that the longer this draws out, and the more of their former acolytes they see on TV slowly switching narratives, it gives them any comfort?

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

d15616  No.16247432

File: 5835330ac76f6a8⋯.jpg (78.04 KB, 613x380, 613:380, filterwithyourmind.jpg)

>>16247308

no, but i believe q team said it wouldn't happen again.. And that was the whole point of letting it happen

I you see the pissed off people on Tik Tok you will realize that peeps will camp out at the drop boxes. take pictures, have sheriffs ready, dox , etc.

People are very fired up over the betrayal

anons are used to it, knowing about it for years / decades.

But some people who just found out, have a lot of energy and are far from burned out.

anons have top energy as well; stamina.

When Congress reconvenes after the election, there will be a lot of opportunity for investigations. So if they do it again… NOPE

They're even getting caught this time

Only time until the list of who didi it is public

Surely people are wondering if any of them live near them, or are maybe even a relative, acquaintance or Friend.

What about Facebook? Are they all on Facebooked?

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

54d19b  No.16247433

>>16247363

Jews are the real "White Supremacists" even though they keep insisting that they aren't White.

They want to eliminate all non-Jewish Whites and set themselves up as the Lords & Masters of all POC.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

ffeb42  No.16247434

>>16247402

>>16247402

The property in Studio City — including a home with six bedrooms and bathrooms, a swimming pool, a soundstage and office space — is meant to be both a meeting venue and a campus for Black artists.

For Black Artists? Black only? They have surely received Big Money, Corporate Money, Govt Money?

They are given a license to discriminate too!

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

2d83e4  No.16247435

File: eb6ac3837830724⋯.mp4 (13.43 MB, 192x144, 4:3, 9convertcom_Dr_Oz_promotes….mp4)

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

70c5d1  No.16247436

File: fec49b77533155e⋯.jpg (97.58 KB, 748x960, 187:240, downloadfile_5.jpg)

Don't forget about this Friday.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

112eda  No.16247437

File: 4b9ba8abd92c87c⋯.png (413.5 KB, 785x598, 785:598, ClipboardImage.png)

File: 533edb8bc251979⋯.gif (794.11 KB, 415x498, 5:6, planefag_snoopy.gif)

Europe-Med activity

Starting over Israel

Israeli AF 4X980 Nachshon Eitam G550 ISR and 684 Nachshon Sahvit G550 out of Nevatim AB-the Nachshon Squadron (ISR-EW ACs base)-Italians have same AC as the Eitam -it's been up over the last two weeks as PERSE or it's tail # over northern Romania

Israeli AF 272 707 Re-'em tanker over Tel Aviv-this has made trips to Dover and JBA in the past

Cont. Europe

NATO01 E-3A Sentry AWACS in it's customary position over eastern Romania

Croatian AF 9ACRO CL600 (PM or Pres) departing Zagreb

Italian AF IAM4660 C-130 Hercules sw after Rzesow load out

3 USAF F-16s out of Aviano AV BUZZRD11 and 12 =23and VIPER32

FALCN69 USAF Learjet sw from Siaaulenai, Lithuania- 69 at least it's not ANAL69

French AF FAF9025 E-3F Sentry AWACS runnin' circles over Rothy land in central France

RAF RRR7240 RC-135 Rivet Joint ran some patterns over eastern Estonia and now over the southern Baltic Sea north of Gdansk-watching for doze 'bad' Russian subs

REDEYE6 USAF E-8C Joint STARS in it's customary position east of Warsaw

Belgian AF BAF82 Falcon 7x south from Andøya AS, Norway it arrived yesterday

High level Swedish AF SVF638 G4 ssw from Stockholm-PM Magdalena Andersson going somewhere in Spain-prolly Madrid-NATO meeting end of June dhere Swedish PM used this to go to Copenhagen to meet with PM Modi

and in BoJo news

Boris Johnson to sign defence deal in Sweden on Wednesday

https://www.thelocal.se/20220510/boris-johnson-to-sign-defence-deal-in-sweden-on-wednesday/

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

36d6d8  No.16247438

File: 378a151c7e28746⋯.jpg (12.51 KB, 600x450, 4:3, ayylmao_hotair.jpg)

Heard a subcommittee in the US House of Representatives is dragging out the AYYYY LMAOOO distraction

PANIC!!!

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

e0487e  No.16247439

File: 3e593a0a6869ff4⋯.png (191.48 KB, 1296x382, 648:191, VOTE_FOR_THE_PEOPLE_PDJT_E….png)

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

112eda  No.16247440

File: 9e7ab9aac042073⋯.png (337.09 KB, 557x387, 557:387, ClipboardImage.png)

morning

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

a53952  No.16247441

YouTube embed. Click thumbnail to play.

🙏WWG1WGALOVE (YOU) ALL ❤I cannot expand the images

Good Morning Commander's 🙏❤🇺🇲

Good Morning Anon Watchmen Warrior Patriot's World Wide 🌎❤🙏🇺🇲

Watcher's I am leaving for the Dentist ,

I have been UP all night

my eyes are red shot

please do not make fun of me

Love Always ❤ WWG1WGA

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

b47849  No.16247442

>>16247344

wow. you really have it all figured out. NOT. Just a shill with the continuing line of attack on patriots. You really have no fucking clue.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

45b0ac  No.16247443

>>16247396

Like a sickness?

That's a weird analogy.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

0cb70c  No.16247444

File: 6fa22c3143ad19f⋯.png (1.32 MB, 1023x682, 3:2, ClipboardImage.png)

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

54d19b  No.16247445

>>16247432

>have sheriffs ready

kek

why haven't these sheriffs already arrested the people who cheated in 2020 and every year before that? The same people who are responsible for the cheating are the ones who own the Sheriffs. The Sheriffs are "elected"

The whole System is rotten to the core.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

4b2e7a  No.16247446

>>16247350

looks like Toronto ….severely mentally deranged people messing with kids; who raises kids like this?

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

e0f89c  No.16247447

File: c8c11a7c8e02eb9⋯.png (87.9 KB, 1180x390, 118:39, Screen_Shot_2022_05_10_at_….png)

After seeing what Joe Biden has done in the last 16 months, I’d like to thank him for not doing anything in 47 years.

https://twitter.com/RyanAFournier/status/1523663864344113153

kek

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

b0af5d  No.16247448

>>16247351

Step 1

Omit the sugar

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

e24a5d  No.16247449

Notables Check == 0 atm

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

b0aad6  No.16247450

File: 51a7a0dec432dc5⋯.jpg (51.21 KB, 640x400, 8:5, tucker_preventing.jpg)

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

e24a5d  No.16247451

NOTABLE

>>16247449 not 1 call out atm

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

6e3f7f  No.16247452

>>16247441

Good luck at the dentist

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

b0af5d  No.16247453

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

241014  No.16247454

File: b2ed117ca473ca9⋯.jpeg (72.77 KB, 1240x697, 1240:697, B0E71701_A4C2_48D3_9135_1….jpeg)

File: 552560cc95425db⋯.jpeg (93.98 KB, 650x670, 65:67, 336EE43A_327A_47A1_8355_7….jpeg)

File: 23df21068dbb7e4⋯.jpeg (104.6 KB, 607x706, 607:706, C20EF472_2FBB_45A7_9BA8_4….jpeg)

File: ae3bc45cdca61f6⋯.jpeg (103.01 KB, 606x689, 606:689, 17F5AA1D_F964_40CF_8AD0_A….jpeg)

10 May, 2022 13:27

Civilians killed in Donetsk shelling – officials

The Donbass republic said Ukrainian forces have been striking residential areas

More civilians have been killed and hurt in Donetsk after two straight days of shelling by Ukraine, officials from the Donetsk People’s Republic (DPR) said on Tuesday.

Two people were killed and five wounded, including a child, in the city’s northern Kievsky district, DPR officials said. They added that four people were also injured during shelling of the Kirovsky district in the western part of Donetsk.

Videos from the scene show missile parts lying on the ground.

“People were screaming, and some were hurt. I immediately went outside to administer first aid and to look whether there was any damage,” a local woman told RT.

“I saw munitions [on the ground], and a little bit farther I saw huge fires – the stores were burning … The same thing happened yesterday – more shelling.”

Officials reported that the city was struck several times on Monday, when residents were celebrating the 77th anniversary of the victory over Nazi Germany in World War II. The fatalities included a 16-year-old, they said.

Ukraine has previously denied targeting civilians and has repeatedly accused Russia of shelling residential areas in Kiev and elsewhere. Moscow, however, insists that it only hits military targets.

https://www.rt.com/news/555247-donetsk-shelling-missiles-report/

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

36d6d8  No.16247455

>>16247306

You glow faggot, kys

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

262f82  No.16247456

According to 2000 mules, all the ballot mules were getting paid per ballot. Follow the money.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

54d19b  No.16247458

>>16247434

Jews still own Black People. Black people are slaves to the Jews. They have been bought with tax payer money. They do the Jew's bidding.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

e0487e  No.16247459

>>16247438

Tucker's had a slot ready for that. He brings it out every 6 months or so. It's… laughable.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

e24a5d  No.16247460

>>16247447

wonder how the 17th month is going to go

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

b0af5d  No.16247461

>>16247350

>soy

That's funny

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

70c5d1  No.16247462

File: dd29ab8aee16d7e⋯.jpg (62.94 KB, 500x500, 1:1, 6e4dl0_1.jpg)

>>16247311

>>16247311

>>16247311

She could be like that black whore in Utah (Love) she ran the same campaign style and when she got to Washington DC she did a 180° on white conservatives….. I don't trust blacks and never will.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

498b4d  No.16247463

File: 6fb71b444167daa⋯.png (724.33 KB, 953x535, 953:535, ministry_of_truth_2.png)

File: 4bed37539e86820⋯.jpg (104.64 KB, 1200x675, 16:9, are_we_there_yet.jpg)

File: 72bbc49853ed026⋯.jpg (169.76 KB, 1200x675, 16:9, trump_said_house_cards.jpg)

File: b6beb92c1502f5d⋯.jpg (132.82 KB, 1200x675, 16:9, adam_schiff_liar_liar_001.jpg)

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

54d19b  No.16247464

>>16247435

The kids don't have gender dysphoria.

They have kooks for parents.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

b0aad6  No.16247465

File: 7de4e923a19413a⋯.png (214.32 KB, 454x404, 227:202, ClipboardImage.png)

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

b0af5d  No.16247466

>>16247441

Be best

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

a82769  No.16247467

>>16247445

Sherriff's departments are run by literal cop gangs, like the LASD Executioners, Banditos, Jump Out Boys, etc. They are connected to every other form of organized crime, and are the reason why we don't have secure elections or Justice. FTP

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

e0f89c  No.16247468

File: 13629681aef3c6a⋯.png (138.4 KB, 1174x642, 587:321, Screen_Shot_2022_05_10_at_….png)

NEW - EU Commission is expected to publish the draft law on "chat control" tomorrow. Lawmakers seek AI-based checks of all message content & images directly on users' devices.

Critics say this is an attack on the digital privacy of correspondence and leads to mass surveillance.

https://twitter.com/disclosetv/status/1524022831188688905

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

2d83e4  No.16247469

Political and cultural relations between Poland and Persia began centuries ago. In 1474 Ambrogio Contarini, the envoy of Venetia, delivered to the Polish king Casimir Jagiellonian a letter from Shah Uzun Hassan. The first documented visit of a Polish envoy, Sefer Muratowicz, took place in 1602. One of his tasks was to buy a Persian carpet for the Polish court.

The diplomatic political agenda included coordination of actions in opposition to the Ottoman Empire as well as the protection of Christians in Persia by Persian shahs and Polish kings. A Polish priest Tadeusz J. Krusiński was invited by Persian authorities to assist in the creation of the first Iranian diplomatic archive.

The most dramatic episode in the history of Polish-Iranian interactions came with the appearance of some 116,000 refugees from the Soviet Union in 1942, who found safe-haven on Iranian soil during the Second World War. Without any exaggeration it was the largest European migration trough Iran. Eighty-five thousand Polish soldiers soon left Iran for Iraq and Palestine, eventually going on to Italy. But Polish civilians stayed longer in Iran, some for a whole lifetime. Polish people were welcomed and treated with friendliness by Iranians.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

784d35  No.16247470

>>16247325

>remove commie marxist nazi fascist maoist eugenicist lenonist socialist globalist terrorist pedoist and identity fraud

Got a better idea motherfucker then let's hear it. I give one fucking rat's as if you're annoyed. Fuck you.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

498b4d  No.16247471

File: 812eb00c97c4abf⋯.jpg (106.79 KB, 1200x675, 16:9, lets_go_brandin.jpg)

File: c74fe63dd989ce4⋯.jpg (192.62 KB, 1200x675, 16:9, lets_go_brandon_worldwide.jpg)

File: b58e461304016ce⋯.jpg (108.91 KB, 1200x675, 16:9, brandon_airlines.jpg)

File: 210511f87fe845d⋯.jpg (88.86 KB, 1200x675, 16:9, joe_begs_for_riots.jpg)

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

70c5d1  No.16247472

File: 20ef4cd89798941⋯.jpg (45.08 KB, 500x484, 125:121, Made_by_Muh_Dick.jpg)

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

b0aad6  No.16247473

File: 5249ab4c60f2c74⋯.png (148.77 KB, 438x317, 438:317, ClipboardImage.png)

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

a53952  No.16247474

>>16247452

Thank(You) Anon Watchman Warrior Patriot ❤ ,

If (You) are a Watcher , 1st , Thank(You) for ALL that (You) do. !!!! can (You) please tell Q I am redoing the LZ again , Thanks Love Always Patriot

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

b0aad6  No.16247475

>>16247468

They need to slow their shit witch hunt down. they threatened DogE

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

21eb2a  No.16247476

File: 26d99edf4b91a48⋯.png (228.82 KB, 1227x393, 409:131, ClipboardImage.png)

https://www.msn.com/en-us/news/politics/senate-democrats-plan-tuesday-vote-to-confirm-cook-for-fed-post/ar-AAX5HN6?ocid=msedgntp&cvid

(Bloomberg) – Senate Democrats plan to hold votes to confirm Lisa Cook’s nomination to be a Federal Reserve governor on Tuesday, they announced Monday night.

Covid-19 cases among Democrats in the evenly divided chamber have delayed a number of nominations over the past few weeks. A procedural vote failed with some Democrats absent after contracting the coronavirus, sparking a logjam on Federal Reserve and other nominations.

Republicans have united in their opposition against Cook, so a procedural vote to advance her nomination as well as a final confirmation vote both expected Tuesday would likely require a tie-breaking vote from Vice President Kamala Harris in the 50-50 Senate if all senators take part.

Senate Banking Committee Chairman Sherrod Brown, an Ohio Democrat, also said he hopes to quickly confirm a number of President Joe Biden’s other nominees, including Jerome Powell for another term as Fed chair and Philip Jefferson as a governor.

Earlier: Democrats’ Covid Cases Threaten to Delay Fed, FTC Confirmations

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

b0af5d  No.16247477

>>16247427

One time special offer on filters

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

70c5d1  No.16247478

File: 3a7ad5ee5320304⋯.jpg (60.79 KB, 500x616, 125:154, 6fgcih.jpg)

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

784d35  No.16247479

>>16247471

Nice Max. Your office?

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

241014  No.16247480

File: 1ff70ffda90897e⋯.jpeg (257.68 KB, 1240x697, 1240:697, 2BAD164F_02CA_47A7_906B_3….jpeg)

10 May, 2022 00:11

HomeWorld News

US prioritizes arming Ukraine over Covid aid

White House urges Congress to pass both, but weapons for Ukraine are deemed more urgent

Democrats will make a separate $10 billion coronavirus funding proposal so thatnearly $40 billion in weapons and other aid to Ukrainecan be approved more quickly ahead of a “critical” deadline, US President Joe Biden said on Monday.

House Speaker Nancy Pelosi originally had funding for Covid-19 treatments, tests, and vaccinestacked onto a $33 billion proposal for supplemental aid to Ukraine. Republicans, who fully backed funding Ukraine but had a problem with how the Covid funding proposal would affect border policy, had threatened to block it in the Senate.

In a statement on Monday, Biden said he would accept splitting the bill if that would get the Ukraine funds – which have since grown by another $6.8 billion – approved faster.

“We cannot afford delay in this vital war effort. Hence, I am prepared to accept that these two measures move separately, so that the Ukrainian aid bill can get to my desk right away,” Biden said.

“This aid has been critical to Ukraine’s success on the battlefield. We cannot allow our shipments of assistance to stop while we await further Congressional action. We are approximately ten days from hitting this critical deadline,” he added.

Biden did say helping Americans combat the virus was “equally vital” as helping Ukraine, as “more Americans will die needlessly” without timely funding. The US will also miss out on new treatments and “next-generation vaccines under development,” as well as falling behind on “our effort to help lower-income countries get [Covid] vaccines into arms,” the president added.

Democrats wanted to use the Covid funding to get rid of Title 42, a policy that allowed the US to turn away or deport migrants caught crossing the border illegally, on account of the pandemic. Republicans objected.

They did not object to spending more money on Ukraine, however, reportedly agreeingto tack on $3.4 billion in food aid and another $3.4 billion for the US military to replace the equipment Biden sent to Ukrainefrom the Pentagon stockpiles, according to Roll Call. The Ukraine bill is still being finalized, and could appear in the House as early as Tuesday.

Earlier on Monday, Biden signed the ‘Ukraine Democracy Defense Lend-Lease Act Of 2022’, a WWII-era scheme to funnel weapons and other equipment to the government in Kiev, approved by Congress at the end of April. The signing was scheduled for the day Russia celebrates victory in WWII over Nazi Germany – which Biden completely ignored, choosing instead to bring up the 1950 founding of the precursor to the EU, and praise the “Allied nations’ defeat of the scourge of fascism in Europe” on May 8 – the date on which the Nazis surrendered to the US and UK troops on the continent, but not to the Soviets.

https://www.rt.com/news/555220-ukraine-congress-covid-relief/

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

498b4d  No.16247481

File: 3ab3a18dc8ffeef⋯.jpg (177.31 KB, 1200x675, 16:9, god_woke_you_up_01.jpg)

File: 6ea85da85a5f266⋯.jpg (178.53 KB, 1200x675, 16:9, god_woke_you_up_03_.jpg)

File: 5c39ae3d0e1ec52⋯.jpg (258.53 KB, 1200x675, 16:9, god_woke_you_up_08_.jpg)

File: 296bd4be74087de⋯.jpg (119.77 KB, 1200x675, 16:9, god_woke_you_up_12_.jpg)

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

007b01  No.16247482

The Swamp Today

Tuesday, May 10, 2022

The Senate stands adjourned until May 10, 2022 at 10:00 AM EDT

The House stands adjourned until May 10, 2022 at 2:00 PM EDT

Deputy Secretary McKeon is on travel to Qatar from May 9-13, 2022.

Assistant Secretary Sison is on travel to Switzerland from May 9-11, 2022.

Congressional Record (Most Recent Issue) Daily Digest

https://www.congress.gov/congressional-record

Senate Executive Calendar

Tuesday, May 10, 2022

https://www.govinfo.gov/content/pkg/CCAL-117scal-2022-05-09/pdf/CCAL-117scal-2022-05-10.pdf

House Activities

Tuesday, May 10, 2022

https://live.house.gov/?date=2022-05-10

Constitution Annotated

Browse the Constitution Annotated

https://constitution.congress.gov/browse/introduction/

. . .

May 10, 2022 - May 12, 2022

5th Meeting of the Strategic and Technical Advisory Group of Experts (STAGE) for Maternal, Newborn, Child and Adolescent Health and Nutrition (MNCAHN)

World Health Organization (WHO), United Nations

https://www.who.int/news-room/events/detail/2022/05/10/default-calendar/upcoming-fourth-meeting-of-the-strategic-and-technical-advisory-group-of-experts-(stage)-for-maternal-newborn-child-and-adolescent-health-and-nutrition-(mncahn)

May 10, 2022 - May 11, 2022

GIS for a Sustainable World Conference

Esrs

https://www.esri.com/en-us/about/events/gis-sustainable-world/overview

May 10, 2022 - May 11, 2022

2:00 PM EDT

The Mortgage Market Research Conference

Federal Reserve Bank of Philadelphia

https://www.philadelphiafed.org/calendar-of-events/mortgage-market-research-conference-2022

May 10, 2022 - May 11, 2022

Workshop: The Case for a Coordinated Global Greenhouse Gas Monitoring Infrastructure

World Meteorological Organization (WMO), United Nations

https://public.wmo.int/en/events/workshops/workshop-case-coordinated-global-greenhouse-gas-monitoring-infrastructure

8:00 AM EDT

Federated traffic prediction for 5G and beyond

AI for Good is organized by ITU in partnership with 40 UN Sister Agencies and co-convened with Switzerland

https://aiforgood.itu.int/event/federated-traffic-prediction-for-5g-and-beyond/

https://www.youtube.com/watch?v=mf5kxVcB-gI

9:00 AM EDT

Cybersecurity and the Financial Sector: The Third-Party Risk Challenge

The World Bank

https://www.worldbank.org/en/events/2022/04/28/cybersecurity-and-the-financial-sector-the-third-party-risk-challenge

9:00 AM EDT

Climate Action Down on the Farm: Food and Climate Nexus Opportunities in China and the US

Woodrow Wilson Center Environmental Change and Security Program (ECSP) and China Environment Forum

https://www.wilsoncenter.org/event/climate-action-down-farm-food-and-climate-nexus-opportunities-china-and-us

9:00 AM EDT

U.S. and European Strategies to Tackle Human Rights in Global Supply Chains

Center for Strategic and International Studies (CSIS)

https://www.csis.org/events/us-and-european-strategies-tackle-human-rights-global-supply-chains

https://www.youtube.com/watch?v=k2sg3JTv6AI

9:30 AM EDT

OPEN/CLOSED: To receive testimony on worldwide threats; to be immediately followed by a closed session in SVC-217.

Honorable Avril Haines

Director of National Intelligence

Lieutenant General Scott Berrier

Director, Defense Intelligence Agency

https://www.defense.gov/News/Live-Events/#/?currentVideo=28703

https://www.c-span.org/video/?519983-1/director-national-intelligence-avril-haines-testifies-worldwide-threats

https://www.congress.gov/event/117th-congress/senate-event/332476

https://www.armed-services.senate.gov/hearings/to-receive-testimony-on-worldwide-threats

9:45 AM EDT

The Financial Stability Oversight Council Annual Report to Congress

Senate Committee on Banking, Housing, and Urban Affairs

Treasury Secretary Yellen Testifies on Annual Financial Report

https://www.c-span.org/video/?519982-1/treasury-secretary-yellen-testifies-annual-financial-report

https://www.congress.gov/event/117th-congress/senate-event/332470

https://www.banking.senate.gov/hearings/05/03/2022/the-financial-stability-oversight-council-annual-report-to-congress

1

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

b0aad6  No.16247483

>>16247480

Dishonorable Treason.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

b0aad6  No.16247484

>>16247482

Demoralizing shit news.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

21eb2a  No.16247485

File: 772eeb865185028⋯.png (98.69 KB, 1223x390, 1223:390, ClipboardImage.png)

https://www.msn.com/en-us/news/technology/how-to-watch-the-super-flower-blood-moon-total-lunar-eclipse/ar-AAX6MEs?ocid

Aspectacular full moon is fast approaching, with plans to grace the night sky on Sunday night. It marks not only a supermoon, but also a blood moon — thanks to a lunar eclipse.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

007b01  No.16247486

>>16247482

10:00 AM EDT

Hearings to examine the nomination of Kalpana Kotagal, of Ohio, to be a Member of the Equal Employment Opportunity Commission.

Senate Health, Education, Labor, and Pensions Committee

https://www.congress.gov/event/117th-congress/senate-event/332469

https://www.help.senate.gov/hearings/nomination-of-kalpana-kotagal-to-be-a-member-of-the-equal-employment-opportunity-commission

10:00 AM EDT

Hearings to examine proposed budget estimates and justification for fiscal year 2023 for the Department of Agriculture

Senate Appropriations Subcommittee on Agriculture, Rural Development, Food and Drug Administration, and Related Agencies

https://www.congress.gov/event/117th-congress/senate-event/332473

https://www.appropriations.senate.gov/hearings/a-review-of-the-presidents-fiscal-year-2023-budget-request-for-the-us-department-of-agriculture

10:00 AM EDT

Hearings to examine proposed budget estimates and justification for fiscal year 2023 for the Department of the Army.

Senate Appropriations Subcommittee on Department of Defense

https://www.appropriations.senate.gov/hearings/a-review-of-the-presidents-fiscal-year-2023-funding-request-and-budget-justification-for-the-department-of-the-army

https://www.congress.gov/event/117th-congress/senate-event/332475

10:30 AM EDT

FDIC and OCC Host Banker Economic Inclusion Roundtable in Rochester, New York

The Federal Deposit Insurance Corporation (FDIC) and Office of the Comptroller of the Currency (OCC)

https://www.fdic.gov/consumers/community/events/2022-05-10-banker-economic-inclusion-roundtable.html

10:55 AM EDT

ISS Expedition 67 in-flight interviews with the Associated Press and ABC News and astronauts Jessica Watkins of NASA and Samantha Cristoforetti of ESA (European Space Agency

NASA

https://www.youtube.com/watch?v=nA9UZF-SZoQ

https://www.youtube.com/watch?v=21X5lGlDOfg

11:30 AM EDT

President Biden Delivers Remarks on the Economy

President Biden Delivers Remarks on his Plan to Fight Inflation and Lower Costs for Working Families, and Contrast his Approach with Congressional Republicans’ Ultra-MAGA Plan to Raise Taxes on 75 Million American Families and Threaten to Sunset Programs Like Social Security, Medicare, and Medicaid

https://www.youtube.com/watch?v=42CMoc0vqZ4

12:00 PM EDT

Closed hearings to examine certain intelligence matters.

Senate Intelligence (Select) Committee

https://www.congress.gov/event/117th-congress/senate-event/328058

12:00 PM EDT

FDIC Hosts Developing Bank Accounts Tailored for Unbanked Communities for Boise, Idaho

The Federal Deposit Insurance Corporation (FDIC)

https://www.fdic.gov/consumers/community/events/2022-05-10-dba-tailored-unbanked-communities.html

12:00 PM EDT

An Exit Interview with Henrietta Fore, former Executive Director of UNICEF

Center for Strategic and International Studies (CSIS)

https://www.csis.org/events/exit-interview-henrietta-fore-former-executive-director-unicef

https://www.youtube.com/watch?v=_Kl_hqTwBGw

1:00 PM EDT

FY 2023 Budget Request for the Department of Transportation

The Honorable Pete Buttigieg

Secretary, Department of Transportation

House Appropriations Subcommittee on Departments of Transportation, and Housing and Urban Development, and Related Agencies

https://appropriations.house.gov/events/hearings/fy-2023-budget-request-for-the-department-of-transportation

https://www.congress.gov/event/117th-congress/house-event/114719

https://www.youtube.com/watch?v=oaE6ZSZ8fOA

2/3

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

54d19b  No.16247487

>>16247467

SCAB

Some

Cops

Are

Bastards

The ones that aren't are clueless that they are part of a criminal organization. But most of them still have asshole, bully mentality.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

f6284f  No.16247488

>>16247446

It's Toronto.

>>16247350

Source.

https://soytoronto.com/about/

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

b0aad6  No.16247489

>>16247486

demoralizing shit news 2/3

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

007b01  No.16247490

>>16247482

>>16247486

2:00 PM EDT

There will be an On-Camera, On-the-Record Department Press Briefing with Spokesperson Ned Price in the Press Briefing Room

Department of State

https://www.youtube.com/statedept

https://www.dvidshub.net/webcast/28724

2:00 PM EDT

Defense Department Briefing with John Kirby

Pentagon

https://www.c-span.org/video/?520116-1/defense-department-briefing

https://www.defense.gov/News/Live-Events/#/?currentVideo=28722

https://www.dvidshub.net/webcast/28722

2:00 PM EDT

Conversations on Equity: Philanthropy's Role in Pursuing Economic Equity

Federal Reserve Bank of St. Louis

https://events.stlouisfed.org/event/b2111a69-5af5-4874-a5a1-06b0b94bbbf4/summary

2:00 PM EDT

H.R. 903 — Rights for the TSA Workforce Act of 2021; H.R. 2499 — Federal Firefighters Fairness Act of 2022; H.R. 5129 — Community Services Block Grant Modernization Act of 2022

House Rules Committee

https://www.congress.gov/event/117th-congress/house-event/114737

https://rules.house.gov/news/announcement/meeting-announcement-tuesday-may-10-2022

2:30 PM EDT

Press Briefing with Press Secretary Jen Psaki

The White House

https://www.youtube.com/watch?v=h1XJoRQsUzc

2:30 PM EDT

Hearings to examine the nomination of Bridget A. Brink, of Michigan, to be Ambassador to Ukraine, and other pending nominations.

Senate Foreign Relations Committee

https://www.c-span.org/video/?520031-1/confirmation-hearing-ambassador-ukraine

https://www.congress.gov/event/117th-congress/senate-event/332467

https://www.foreign.senate.gov/hearings/nominations-051022

2:30 PM EDT

A joint hearing to examine the Shipyard Infrastructure Optimization Program.

Senate Armed Services Subcommittee on SeaPower

https://www.congress.gov/event/117th-congress/senate-event/332485

https://www.armed-services.senate.gov/hearings/to-receive-testimony-on-the-shipyard-infrastructure-optimization-program

2:30 PM EDT

To receive testimony on Army Modernization in review of the Defense Authorization Request for Fiscal Year 2023 and the Future Years Defense Program

Senate Armed Services Subcommittee on Airland

https://www.armed-services.senate.gov/hearings/to-receive-testimony-on-army-modernization-in-review-of-the-defense-authorization-request-for-fiscal-year-2023-and-the-future-years-defense-program-

https://www.congress.gov/event/117th-congress/senate-event/332486

2:30 PM EDT

Closed business meeting to consider pending intelligence matters; to be immediately followed by a closed briefing on certain intelligence matters.

Senate Intelligence (Select) Committee

https://www.congress.gov/event/117th-congress/senate-event/332064

2:50 PM

SpaceX Falcon 9 Starlink 4-13

Vandenberg Space Force Base, California

https://www.youtube.com/c/SpaceX/videos

https://www.spacetv.net/live/launch-of-spacex-falcon-9-with-starlink-group-4-13/

POSTPONED UNTIL May 12, 2022

3:00 PM EDT

Unmanned Aircraft System (UAS) Traffic Management (UTM) Operational Safety Analysis

International Civil Aviation Organization (ICAO), United Nations

https://www.icao.int/Meetings/DEWebinars2022/Pages/UTM-Operational-Safety-Analysis.aspx

8:00 PM EDT

Seminar "World Development Report 2022: Finance for an Equitable Recovery"

World Bank and JICA Ogata Sadako Research Institute for Peace and Development

https://www.worldbank.org/en/events/2022/05/11/seminar-wdr2022-finance-for-an-equitable-recovery

. . .

3/3

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

345719  No.16247491

>>16247409

Global Reported, and I didn't click that shit nigga.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

ffeb42  No.16247492

>>16247433

>>16247458

An observation: Jewish supremacy is what they practice. They don’t even hide it!

Look at the percentage as a population and you’ll see why people say the things they say ( which is always countered with calls and accusations of antisemitism) like why are all the doctors, lawyers, diamond dealers, jewelry makers, US politicians, body parts salesmen, pro-abortion advocates all fucking Jewish!

Don’t try to to tell me it’s because they are smart!

Diabolical and bigots, yes, smart? Not so much.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

498b4d  No.16247493

File: 089218f0e325ea5⋯.jpg (117.96 KB, 1200x675, 16:9, capt_obvious_legal_votes.jpg)

File: 171bbf4762412d5⋯.jpg (476.42 KB, 960x1200, 4:5, us_and_them_001.jpg)

File: 43402084ddc56ec⋯.jpg (110.75 KB, 1200x675, 16:9, restore_every_legal_vote_2.jpg)

File: 7b64d60ee947cbb⋯.jpg (134.51 KB, 1200x675, 16:9, adam_knew.jpg)

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

fdd8fd  No.16247494

File: a2f144a3e5b3d45⋯.png (1.32 MB, 1080x1091, 1080:1091, f8d0c0c4f695e7dd367c3e7d71….png)

>>16247242

mornin Swordy!

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

241014  No.16247495

File: 853dd7b2490bf60⋯.jpeg (299.97 KB, 1240x697, 1240:697, 3B70764A_FDED_49CA_AC65_7….jpeg)

10 May, 2022 13:07

HomeBusiness News

German firm meets key demand on Russian gas payment

VNG will transfer euro payments to a new account with Russia’s Gazprombank

Germany’s third-largest gas importer, VNG, has agreed to Moscow’s new ruble-based gas payment scheme and opened the necessary accounts with Russia’s Gazprombank to transfer payments, the company said in an emailed statement to Reuters on Monday.

“We will pay the invoice amount, which will continue to be denominated in euros, into the accounts at Gazprombank in accordance with the planned procedure, so that timely payment to our supplier is ensured on our part,” the statement read.

The company added that it expects the conversion into rubles to not cause any difficulties, noting that “the opening of the account went completely smoothly.”

Russia’s new ruble-based gas payment mechanism was introduced on March 31 amid Moscow’s military operation in Ukraine and the resulting Western sanctions. The news puzzled Russian gas buyers, who feared they would be expected to pay for the commodity in rubles. However, it was later clarified that buyers will be able to pay in their currency of choice, but must first set up an account in Russia’s Gazprombank so their payments can be converted into rubles before reaching the gas provider, Gazprom. The measure applies to buyers from ‘unfriendly states’ which placed sanctions on Russia.

European gas buyers are still concerned about the new payment scheme, fearing it could breach the sanctions, but at the same time, many are not eager to cut off Russian gas imports. Several Russian gas buyers have recently signaled that they might be able to comply with Moscow’s requirements. At the end of April, Uniper, a major German importer of Russian gas, said it would be possible to pay for future supplies without breaching sanctions. According to a Bloomberg report, four European countries have already made gas payments to Russia using Moscow’s new ruble-based mechanism, while at least 10 countries have set up ruble accounts in Gazprombank, through which they plan to make payments due at the end of May.

VNG said it is taking all necessary measures to comply with the sanctions law, but also to ensure gas supplies to Germany.

https://www.rt.com/business/555242-germany-vng-russian-ruble-gas/

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

3594fa  No.16247496

File: 8e8a2de9ec93987⋯.jpg (34.04 KB, 474x311, 474:311, download_23_LAPTOP_ACVRQI6….jpg)

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

83625a  No.16247497

“If you really want to do something, you'll find a way. If you don't, you'll find an excuse.”

Jim Rohn

Message to Trump.

“If you really want to do something, you'll find a way. If you don't, you'll find an excuse.”

Jim Rohn

EXPLAIN WHY YOU DIDN'T STOP THE RIOTING???..NO EXCUSES!!!

EXPLAIN WHY THE TRUTH HASN'T COME OUT ON…..9/11, BENGHAZI, COVID-19, ETC….???

WHY DOES THE GOVERNMENT LIE ALL THE TIME, INCLUDING, GOVERNORS, MAYORS, CONGRESS MEMBERS, DOJ/FBI/CIA.ETC…???……WHY????

WHEN WILL IT…..STOP????????

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

a1c6db  No.16247498

#Trumpette2Q22

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

32c708  No.16247499

File: 45a69c834133305⋯.jpg (18.8 KB, 211x255, 211:255, 1651283333.jpg)

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

70c5d1  No.16247500

File: 802964ade3b5019⋯.jpg (46.05 KB, 667x457, 667:457, downloadfile_7_1_.jpg)

>>16247483

>>16247480

>>16247480

Ukraine aid kickback money is pallets of cash not even going to the Ukraine it is heading to private Swiss bank accounts owned by democrats.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

b0aad6  No.16247501

>>16247490

demoralizing shit news 3/3

Most those sources are shit sources or tainted agencies without honor integrity or confidence.

State Dept

house.gov

c-span

csis

closed hearings

fdic + give money to nazis

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

3afc9d  No.16247502

File: d4490db953d4b99⋯.jpg (197.44 KB, 1200x900, 4:3, narwhale.jpg)

File: 93f96c7f5d03f4e⋯.jpeg (10.65 KB, 255x204, 5:4, lurking_grammar_nazi.jpeg)

>>16247478

>bitches

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

498b4d  No.16247503

File: 7fa4f1702990dc4⋯.jpg (2.69 MB, 1800x2300, 18:23, 7fa4f1702990dc4f89c31b5c12….jpg)

File: 0abd22d699cfda6⋯.jpg (70.97 KB, 559x340, 559:340, 67c44fabe7b222c48176bc1758….jpg)

File: 603bc261bcf599b⋯.png (328.9 KB, 612x612, 1:1, 603bc261bcf599b11023a3434f….png)

File: 87418c1745f1afa⋯.jpg (43.85 KB, 960x540, 16:9, 87418c1745f1afad140d1ee11c….jpg)

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

21eb2a  No.16247504

File: 93df658c422cb04⋯.png (306.65 KB, 1233x394, 1233:394, ClipboardImage.png)

https://www.msn.com/en-us/news/politics/biden-to-blast-republicans-as-having-no-plan-on-inflation/ar-AAX6e1H?ocid

By Trevor Hunnicutt

WASHINGTON (Reuters) - U.S. President Joe Biden will use a speech on inflation on Tuesday as an opportunity to turn his Democratic Party's top political liability ahead of the midterm elections into an argument against Republicans.

As Americans worry about a spike in inflation that has pushed consumer prices more than 8% higher, the president will highlight a number of his administration's steps to cut prices.

He is not expected to announce new policy measures in the speech, which comes a day before new consumer price data is expected to show inflation remained elevated through April.

But he is expected to sharpen his attacks on Republicans six months before the Nov. 8 midterm elections, where Democrats want to retain narrow majorities in the Senate and House of Representatives.

"Republicans love to use inflation as a political talking point, but does anyone have a clue what their plan is to bring down prices?" said a White House official who asked not to be named.

Demand stimulated by government spending and savings accumulated during the COVID-19 pandemic have been no match for creaky supply chains and labor shortages, prompting higher inflation globally.

That has created a political problem as American consumers stare down higher grocery and gas bills exacerbated by measures blocking Russian oil and gas after its invasion of Ukraine, actions that Moscow calls "a special operation."

Fewer than half of U.S. adults - 44% - approve of Biden's handling of the presidency and they rate the economy as the country's most important problem, according to a Reuters/Ipsos poll last week.

Republicans are working to capitalize on the issue in the midterms, promoting steps including loosening regulations on oil and gas producers as well as cutting some taxes and government spending. But the party has not endorsed any policy document outlining the steps they would take on inflation.

Biden has sharpened his attack on Republicans in recent days, including dismissing former President Donald Trump's "Make America Great Again" movement as extreme.

"Voters know that Republican-led states are leading in economic recovery and job creation, and will vote for Republicans and our proven agenda come November," said Emma Vaughn, a spokesperson for the Republican National Committee.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

d181a9  No.16247505

>>16247451

get with the program baker

>>16247332

>>16247437

>>16247482

notable AF

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

e0487e  No.16247506

File: ea2e34a9aeca747⋯.png (68.25 KB, 942x298, 471:149, ClipboardImage.png)

ENDORSEMENTS from PDJT:

Donald J. Trump / @realDonaldTrump 05/10/2022 07:23:55

ID: Not Available

Truth Social: 108277388770242605

Nebraska, go out and vote today for Charles W. Herbster. He will be a great Governor!

Donald J. Trump / @realDonaldTrump 05/10/2022 07:37:33

ID: Not Available

Truth Social: 108277442391683887

Congressman Alex Mooney has done a great job for the people of West Virginia. Vote for him today!!!

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

498b4d  No.16247507

File: 98d10a0db80c0bb⋯.jpg (148.18 KB, 735x991, 735:991, d19445cd85732f53d39dc1b09c….jpg)

File: fa11aa34bc56681⋯.png (328.12 KB, 612x612, 1:1, EK0OtU_WoAUbbbi.png)

File: fac3b1115d29e37⋯.png (72.09 KB, 387x480, 129:160, fac3b1115d29e3776cefd628d1….png)

File: d00dce64fb1c704⋯.jpg (104.83 KB, 800x1000, 4:5, tarmac_movie_008.jpg)

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

0cb70c  No.16247508

File: 652c6ae3b2f7601⋯.png (612.9 KB, 550x640, 55:64, ClipboardImage.png)

>>16247242

Same to ya, Swordy

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

241014  No.16247509

>>16247465

Can someone put Doctor Death in jail for causing mass extinction by this asshole NOW?

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

b0aad6  No.16247510

>>16247497

>WHEN WILL IT…..STOP????????

end smith mundt modernization Act, COG, Patriot Act NDAA.

Start brac 'ing agencies secure their shit.

Make new law and oath to address these shit fuckers from even starting up their fucking shit

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

70c5d1  No.16247511

File: 31962867484411b⋯.jpg (72.77 KB, 500x702, 250:351, Mule.jpg)

File: d6b9893645d61d2⋯.jpg (72.53 KB, 500x672, 125:168, VG_hvy.jpg)

File: 2faa2e7ef292b9a⋯.jpg (52.05 KB, 500x570, 50:57, De_Facto.jpg)

File: 565442731016646⋯.png (827.91 KB, 1025x1148, 25:28, Screenshot_20220505_153254….png)

File: 92e21699a0f0698⋯.jpg (70.71 KB, 500x530, 50:53, 92e21699a0f0698822ba151e79….jpg)

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

5f214a  No.16247512

File: 7477f3b57d0204b⋯.jpeg (12.35 KB, 254x135, 254:135, 6ff4c5d42dd6499f0bda61a32….jpeg)

US Brings Back Cyber Team to Combat Possible Election Meddling

The effort comes amid warnings from U.S. officials that Russia could seek to sway voters during the midterms.

https://www.datacenterknowledge.com/security/us-brings-back-cyber-team-combat-possible-election-meddling

It's almost comical that this is out yesterday. Are they kidding?

Did they check the ballot stuffing and all the zuckbucks and all the overlays of tracking?

Russia had nothing to do with ballot stuffing, ballot traffikcing or whatever you call it now. What the Democrats did in Georgia is illegal and nothing is being done and no one held accountable.

Let's start there and stop worrying about "RUSSIA".

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

21eb2a  No.16247513

File: 32e0c7feba18cd6⋯.png (521.55 KB, 768x598, 384:299, ClipboardImage.png)

https://www.msn.com/en-us/news/us/transgender-treatment-doctors-threatened-by-new-alabama-law/ar-AAX59nx?ocid

Associated Press

Transgender treatment, doctors threatened by new Alabama law

By KIM CHANDLER, Associated Press - Yesterday 1:40 PM

BIRMINGHAM, Ala. (AP) — Dr. Hussein Abdul-Latif spent the last week typing out prescription refills for his young transgender patients, trying to make sure they had access to their medications for a few months before Alabama made it illegal for him to prescribe them.

Dr. Hussein D. Abdul-Latif, left, and Dr. Morissa Ladinsky, two University of Alabama at Birmingham professors who treat patients with gender issues, speak during an interview in Birmingham, Ala., on Wednesday, April 13, 2022. (AP Photo/Jay Reeves)

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

b0af5d  No.16247514

Are they getting rid of evidence when they get rid of baby formula?

Nestle is a very powerful company. Anon knows people who work in their R&D.

Difficult to believe they have a shortage.

Far moar likely they are scared of the exposure of some ingredient sources.

Start 'em on cannibalism early

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

b47849  No.16247515

File: 9261992bd5f28c2⋯.png (141.11 KB, 241x255, 241:255, ClipboardImage.png)

File: e61450ac776e91d⋯.png (75.24 KB, 190x255, 38:51, ClipboardImage.png)

File: e36a378b2469eb0⋯.png (48.46 KB, 224x255, 224:255, ClipboardImage.png)

File: b90911e6f049e6c⋯.png (104.12 KB, 228x255, 76:85, ClipboardImage.png)

File: 9261992bd5f28c2⋯.png (141.11 KB, 241x255, 241:255, ClipboardImage.png)

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

778aae  No.16247516

File: f444bde9de2c961⋯.png (147.89 KB, 2249x1453, 2249:1453, ClipboardImage.png)

File: 494bdeccca5462c⋯.png (166.09 KB, 1741x1381, 1741:1381, ClipboardImage.png)

>>16247380

Anon would not introduce impossible standard of completeness and consistency (perfection) for any physical object that would itself necessarily be incomplete if it's to even be identified as an existent real, let alone Anon's complex self-reflective formal system called 'self'.

Anon does not see nor need to see nor could claim to see or know without introducing inconsistency, that 'completeness' (attempt to compel an inconsistency in some way to become a consistency from yet another point of view to then escape the deterministic fixed axiom just uttered by the self which an active minded self will necessarily output both inconsistencies if the theorem of completeness was claimed to be idealized and achievable and achieved.

Completeness, contrary to the author's presentation, is not AND CANNOT EVER be an ideal or goal or view of 'true true' reality, of what 'truly' is as opposed to what might accidentally be.

Any complex formal system like every living entity that has ever existed and for any and all practical considerations could only even be closely approximated by estimating how long it would take for humans to develop and take over the entire universe 'ideologically' where all other consciousnesses are pre-populated with the whimsical thoughts of whatever those beings would look like. They wouldn't 'be' God but to the NPC minds everywhere else, they would experience reality as if the physical phenomena is 'natural' and not guided by any intelligence emanating from physical bodies of other lifeforms. But still the 'ruler' would not be God, for even at the infinity, even with every bit of information of the entire universe being controlled by one entity that exists WITHIN THE UNIVERSE AS THE ENTIRE COMPLEX FORMAL SYSTEM OF REALITY ITSELF, that entity would be unable to prove all truths, there would still be knowable truths that the entity with every bit in the universe controlled, could not do it without contradicting itself, without outputting two statements that directly negate the other as true and false.

If the aspiration of philosophy is NOT forever condemned to having to find meaning and value of a species 'in exile' because we have any 'innate deficiency'.

All that talk about people is talk that God is itself inherently divided into the same dialectic logic that has God all of a sudden causing an absence. Anon see big bug with an architecture that outputs the claim that a deficiency can be proved by borrowing from what isn't deficient on one side and also output that that side is a cause of a deficiency on the other side, or vice versa.

Anon see catastrophic bug in assuming that any living entity on Earth introducing two opposites as a means to 'move the world' to where there can be 'completed' tyrannies.

The error as how the subject perceives the source. If any intelligent entity know and see itself as incomplete (if any entity is to consistently output that it is not inconsistent), then all these 'deficiencies' and 'disjunctions' get clarified as to what those thoughts really are about, how to make meaning of them, and then eventually Anon sees that the reason Anon has any awareness of what increasing amounts of completeness is looking to be, Anon's own mind will still be a source of a unified epistemology.

Anon is not 'missing' anything just because Anon can explore imagination of how an incomplete being stands among everyone and everything else.

is not a system to be used by any other living entity let alone the one outputting those contradictions.

This is to say

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

85bc47  No.16247517

>>16247497

an actual real question that most of these clowns will tell you to shut up and trust the plan

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

3afc9d  No.16247518

>>16247504

>U.S. adults - 44% - approve of Biden's handling of the presidency

the parasite percentage is high…what did Willard say? 47%?

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

54d19b  No.16247519

>>16247417

>Chicago is going to be an oasis

Chicago is a cesspool, not an oasis.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

b47849  No.16247520

File: dc12113060b5130⋯.png (141.48 KB, 241x255, 241:255, ClipboardImage.png)

File: dc12113060b5130⋯.png (141.48 KB, 241x255, 241:255, ClipboardImage.png)

File: dc12113060b5130⋯.png (141.48 KB, 241x255, 241:255, ClipboardImage.png)

File: dc12113060b5130⋯.png (141.48 KB, 241x255, 241:255, ClipboardImage.png)

File: dc12113060b5130⋯.png (141.48 KB, 241x255, 241:255, ClipboardImage.png)

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

b47849  No.16247522

File: 98a83abb426534a⋯.png (105.54 KB, 228x255, 76:85, ClipboardImage.png)

File: 98a83abb426534a⋯.png (105.54 KB, 228x255, 76:85, ClipboardImage.png)

File: 98a83abb426534a⋯.png (105.54 KB, 228x255, 76:85, ClipboardImage.png)

File: 98a83abb426534a⋯.png (105.54 KB, 228x255, 76:85, ClipboardImage.png)

File: 98a83abb426534a⋯.png (105.54 KB, 228x255, 76:85, ClipboardImage.png)

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

f6284f  No.16247523

>>16247511

Did the guy have his shitting pants on?

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

b0aad6  No.16247524

File: 4c4340cf6b29e0b⋯.png (24.18 KB, 96x145, 96:145, ClipboardImage.png)

The State Department and the US Military had to have commit treason to give Joe Biden a security clearance

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

ffeb42  No.16247525

>>16247331

Mark my words… Trumps Pa endorsed Oz will not win!

I’m voting Barnett only because of everything she says and does! Many Pa voters are confused by Trumps selection. We are smart enough to see a black woman, in Democrat strongholds like Pittsburgh and Philly, will get more votes.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

b0af5d  No.16247526

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

241014  No.16247527

>>16247419

Anyone dems choose or nominate are the ugliest people on earth, how can they not see it?

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

7a62cd  No.16247528

File: 52d2f748f5a8bdc⋯.png (49.77 KB, 224x255, 224:255, ClipboardImage.png)

File: 52d2f748f5a8bdc⋯.png (49.77 KB, 224x255, 224:255, ClipboardImage.png)

File: 52d2f748f5a8bdc⋯.png (49.77 KB, 224x255, 224:255, ClipboardImage.png)

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

6e3f7f  No.16247529

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

18150a  No.16247530

File: 43bdfe54bf6f683⋯.jpg (17.56 KB, 255x255, 1:1, 5e9ac44dc66d75a4109ca73bb5….jpg)

>thunks hot off the think tank

Every time they fuck up now, those awake get angry.

Even when they take a big issue thinking it will help to their advantage, those awake see right through it get angrier knowing they are continuing to manipulate those political prisoners who are still asleep.

You would say the Roetesters need mental help, but I'd say they need an exorcist and some holy ground.

Tell them no, the sacrifices areOVER!

Racist that you want to kill minority babies in such huge numbers to besold(you mean like a slave?) for bio-scrap.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

112eda  No.16247531

File: 07f242f78e02d18⋯.png (269.13 KB, 703x440, 703:440, ClipboardImage.png)

File: fdfe1b96e78c18f⋯.png (53.58 KB, 1303x438, 1303:438, ClipboardImage.png)

PF housekeeping

The Italian AF AC (IAM3121 Falcon 900) that landed yesterday was not Super Mario Draghi-it was part of the security apparatus for foreign trips

This inbound AC is him and I have seen him on very short trips on the other AC (Falcon) Switzerland, Sicily, Croatia, etc

Italian AF IAM9002 A-319 inbound to DC from Rome depart for empty callsign Joe meeting in a few hours

Because the schedule was not released and the deet's of this meeting (time)-cap#2 were not known I can confirm the inbound AC is 100% Mario Draghi

2pm EST holds a bilateral meeting with Prime Minister Mario Draghi of Italy

https://factba.se/biden/calendar

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

7a62cd  No.16247532

File: 3a098c2977c2abe⋯.png (76.36 KB, 190x255, 38:51, ClipboardImage.png)

File: 3a098c2977c2abe⋯.png (76.36 KB, 190x255, 38:51, ClipboardImage.png)

File: 3a098c2977c2abe⋯.png (76.36 KB, 190x255, 38:51, ClipboardImage.png)

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

13b0fb  No.16247533

>>16247503

Outstanding post, Anon.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

70c5d1  No.16247534

File: 1f0f63741528f11⋯.jpg (74.93 KB, 578x432, 289:216, 6ffy99.jpg)

>>16247502

A meme isn't a meme without some discrepancies..lol

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

241014  No.16247535

>>16247422

They will always choose death and genocide

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

f6284f  No.16247536

File: 52e505d4b559d0f⋯.jpg (Spoiler Image, 23.9 KB, 480x480, 1:1, 1651320575263.jpg)

>>16247527

Are you saying Rachel Levine is not an attractive REAL lady?

I'm sick of this board. Nothing but bigots.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

70c5d1  No.16247537

>>16247526

Hackers…

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

21eb2a  No.16247538

File: f7a628375776960⋯.png (158.91 KB, 308x510, 154:255, ClipboardImage.png)

File: 0e92c421ef17b76⋯.png (155.28 KB, 323x315, 323:315, ClipboardImage.png)

File: 43233cfc60e7e64⋯.png (42.52 KB, 307x304, 307:304, ClipboardImage.png)

File: c2e92d68daa8f97⋯.png (123.77 KB, 317x320, 317:320, ClipboardImage.png)

File: b7603f14d225ec6⋯.png (106.33 KB, 313x321, 313:321, ClipboardImage.png)

uptick in covid fear porn

we called it

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

54d19b  No.16247539

>>16247492

>Don’t try to to tell me it’s because they are smart!

They aren't smart, they are ruthless cutthroats who eliminate their competition.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

27b85a  No.16247540

>>16247497

>WHY DOES THE GOVERNMENT LIE ALL THE TIME, INCLUDING, GOVERNORS, MAYORS, CONGRESS MEMBERS, DOJ/FBI/CIA.ETC…???……WHY????

because people are mentally weak….they do not even qualify as ovine anymore as sheep have filed a restraining order against using them in comparisons; went to dentist yesterday …"sir, you have to have a mask" : uhhh…no i don't ; left laughing and all the eyes behind the mask were despondent ; "sir, sir"

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

18150a  No.16247542

File: 40cd73d45a400a9⋯.png (6.71 KB, 255x215, 51:43, 40cd73d45a400a984e0d94f180….png)

>>16247533

ckt

>>16247503

17 seconds to MAGA

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

112eda  No.16247543

>>16247437, >>16247531, >>16247531 pf report(s): PAT44' heading across the pond/Europe-Med activity/Mario Draghi inbound to DC to meet BOTUS

PF report Bun

>>16247505

ty anon

o7

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

e5b9ed  No.16247544

>>16247504

Here's the Tame Inflation Plan

Joe Biden, Stop being a fucking Moron and reopen our energy in OIL and NATURAL GAS, Take the cap off of COAL. GET out of Europe, NATO is a bunch of war mongering NAZI sympathizers. Defund NASA, we have the Space Force. Stop sending AID to foreign Nations.. we all know that is poor over their ever gets a $1.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

98a143  No.16247545

>>16247468

notable

the uk has already throttled internet searches.

cannot get out on the web without tor which is useless or vpn.

8kun does not without vpn

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

b0af5d  No.16247546

Whiner shills

That's fun

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

e0487e  No.16247547

>>16247538

I do wonder what the "gotcha" will be for the deeply programmed. Like, how far does it have to go to get to that 94-96% number?

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

b0af5d  No.16247548

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

eeabdc  No.16247549

What was the current consensus on vaccine shedding?

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

54d19b  No.16247550

File: 15a9c44aa033721⋯.png (4.02 MB, 2000x1477, 2000:1477, ClipboardImage.png)

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

a1c6db  No.16247552

#Samatha Dove Infinite Jr. 369

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

e5b9ed  No.16247553

>>16247547

Frazzledrip

Pictures from the Ukraine from Russia, showing the rescue of the slave mothers and babies

Evidence from Haiti over Pedovore trafficking

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

9f3ead  No.16247554

File: 1b20b81be10d272⋯.png (218.5 KB, 1704x870, 284:145, ClipboardImage.png)

File: 8d89d67c7fcdcaf⋯.png (244.76 KB, 1691x913, 1691:913, ClipboardImage.png)

File: e22f6c2d2e9e922⋯.png (30.77 KB, 365x414, 365:414, ClipboardImage.png)

>>16247476

https://en.wikipedia.org/wiki/Lisa_D._Cook

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

241014  No.16247555

>>16247311

I agree Barnette is not bought, she knows the corruption. I wish I lived there to vote for her.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

54d19b  No.16247556

>>16247540

curious

how does a dentist work on someone's teeth when the person is wearing a mask?

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

65144e  No.16247557

>>16247491

She is SOOO CUTE Though. think it might be too young For you? Hiding Something?

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

5f214a  No.16247558

>>16240746 pb

>>16240746 pb

2000 Mules

A very important comment from Greg Phillips about the J6 arrests.

He stated unequivocally that the Feds could not have compiled the type of data in 72 hrs to trigger arrests. He states they were likely being tracked prior to J6.

That being said, there are a number of people who may not be aware of a the company Palantir. They are a big data, analytics company doing exactly what Greg Phillips' team did with the petabytes of data True the vote purchased.

Palantir Gotham is the product likely being used.

DHS has a contract with Palantir for Gotham.

There's the reason they called everyone "domestic terrorists" -its so they could use this software to justify spying on Americans.

https://www.washingtonpost.com/business/2019/08/22/war-inside-palantir-data-mining-firms-ties-ice-under-attack-by-employees/

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

2d83e4  No.16247559

File: 8866c15cb8870d8⋯.png (972.67 KB, 1024x768, 4:3, ClipboardImage.png)

Zmeiny Island Update—Combined Sources—May 9, 2019

1—The battle for the Zmeiny Island and the losses of the Ukrainian forces there are being compared, sardonically, to the Battle of Midway. The Ukrainian army has lost 8 (eight) aircraft and 10 (ten) helicopters over the course of one day.

2—It is likely that most of the helicopters were struck while at an intermediate jump landing site, en route to Zmeiny, by four Onyx missiles launched by the Russian forces from Crimea. Unlike Kalibr, Onyx missiles are supersonic, with speed up to 3,000 km/hour. That is why they were used to attack the helicopters, so as not to allow them time to escape the strike.

3—As a result, the Ukrainian air force never made it to Zmeiny island today. After the attack using Onyx missiles on the Chervonoglinsky aerodrome, the Ukrainian Su aircraft turned around halfway to the island. From the intermediate jump landing site in Izmail, the Ukrainian air assets were flown to the north.

4—The Zmeiny island is once again under the control of the Russian forces. [GB: although, judging from a closer reading of the statement of the Russian Ministry of Defence, the defending unit of the Russian army may never have left the island in the first place.]

5—The significant losses of the Ukrainian army are reflected in Rybar's most recent report, for May 9, 2022, as based on the internal conservative estimate reports of the Ukrainian General Staff.

https://en.wikipedia.org/wiki/P-800_Oniks

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

27b85a  No.16247560

File: 02d21f4b8672a97⋯.jpg (16.79 KB, 255x191, 255:191, moran.jpg)

File: 5e5f52903960dfc⋯.png (632.61 KB, 455x668, 455:668, 5e5f52903960dfc07cfa21b1b8….png)

>>16247534

yeah, i know…especially funny ones ; where would moar, moran come from? teh, "all your xyzs are belong" : "be an hero" the classics …and some mistakes are just honest, but takeoff like a rocket (see van heat belts…if you were there that night) : however spelling/grammar can be most important on a serious meme intended for normies and retarded establishmnet taxpayer funded goons (is that redundant?)

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

98a143  No.16247561

File: 41312251f927021⋯.png (410.17 KB, 410x406, 205:203, ClipboardImage.png)

File: 3db4d33a17ae99b⋯.png (280.34 KB, 402x393, 134:131, ClipboardImage.png)

>>16247482

fuck me they are busy.

they do this shit so no one bothers to look at it all.

flood the hearings and then slip through something that no one would notice but is fucked up for the citizens.

one sided gaslighting

who has time for all that.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

0cb70c  No.16247563

YouTube embed. Click thumbnail to play.

State Opening of Parliament

In full: The Queen's Speech read by Prince Charles

Prince Charles reads the Queen's Speech, after Her Majesty pulled out of the ceremony due to ongoing mobility issues.

https://youtu.be/EwFSHlbWIXg

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

5f214a  No.16247564

File: b21aafb7c309c97⋯.png (118.77 KB, 1366x629, 1366:629, ClipboardImage.png)

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

9aafcb  No.16247565

File: 41f5836840a8d7d⋯.png (802.3 KB, 886x892, 443:446, 41f5836840a8d7d58cd6985518….png)

>16247211

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

3768df  No.16247566

>>16247295

She be rockin' dem Pepe-green pants!

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

a1c6db  No.16247567

>>16247552

#JJ: t.me/HSRetoucherQ

#Carolyn: t.me/Q5DSpaCe

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

a1c6db  No.16247569

>>16247567

@TruePatriQt1971

Sumtin up

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

5f214a  No.16247570

>>16247558

Palantir

IN-Q-TEL

Founded in the patriotic fervor that followed the Sept. 11, 2001, terrorist attacks, with $2 million in seed money from aCIA incubator, Palantir has always promoted a mission to defend American interests. Federal authorities rely on its data platform to track down terrorists, insurgents, drug smugglers and insider traders, records show.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

0bad47  No.16247571

File: f21d83b480e786a⋯.jpg (62.44 KB, 500x472, 125:118, 6esgbz_1.jpg)

File: db0c8a1c9cfc95b⋯.jpg (77.93 KB, 500x513, 500:513, 6esggf.jpg)

File: fef5aa9bf474156⋯.jpg (52.54 KB, 500x566, 250:283, 6flhy.jpg)

File: d9c62244f156ea5⋯.jpg (71.41 KB, 500x569, 500:569, 6elsxz_1_1.jpg)

File: bed82b4f1f27d34⋯.jpg (88.19 KB, 500x484, 125:121, 6ey975_1.jpg)

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

2d83e4  No.16247572

>>16247563

>Prince Charles reads the Queen's Speech, after Her Majesty pulled out of the ceremony due to ongoing mobility issues.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

a82769  No.16247573

>>16247572

It's really hard to walk

When you're dead

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

b0af5d  No.16247574

Another sudden death in muh inner circle yesterday.

Perfectly healthy robust senior.

Naively took all the jabs so she could participate in social activities.

Then couldn't participate because the sudden decline in health in the aftermath. Now suddenly gone.

R.i.p.

nice lady she was.

Momanon lost a dear fren and is seeing the light moar each day.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

007b01  No.16247575

Tiger Global hit by $17bn losses in tech rout

Hedge fund suffers ‘breathtaking’ drop as speculative stocks sink from pandemic peaks

Tiger Global has been hit by losses of around $17bn during this year’s technology stock sell-off, marking one of the biggest dollar declines for a hedge fund in history.

The run of poor performance means the firm — one of the world’s biggest hedge funds and a big investor in high-growth, speculative companies whose shares have tumbled since their pandemic peaks — has in four months erased around two-thirds of its gains since its launch in 2001, according to calculations by LCH Investments.

https://www.ft.com/content/caa49a44-18a3-4e51-9dfb-aad61767fe25

https://web.archive.org/web/20220510100226/https://www.ft.com/content/caa49a44-18a3-4e51-9dfb-aad61767fe25

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

112eda  No.16247576

>>16247403

the callsign for that trip referenced was PAT78-same AC though

Don't think they would make it that obvious but…

"these people are stupid"

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

007b01  No.16247577

File: efe1292a525310e⋯.jpg (84.22 KB, 1191x1146, 397:382, queen_eek.jpg)

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

0dbcae  No.16247578

File: c374b78aa7bdfe7⋯.png (90.46 KB, 275x183, 275:183, ClipboardImage.png)

The Left is Cancelling Comedy

Why you need to take right-wing comedy seriously

From Joe Rogan to the Babylon Bee to Steven Crowder, the new book ‘That’s Not Funny’ deconstructs their appeal, and why it matters.

https://www.fastcompany.com/90750474/why-you-need-to-take-right-wing-comedy-seriously

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

e0487e  No.16247579

File: a270b48a5a6ea20⋯.png (352.8 KB, 680x767, 680:767, ClipboardImage.png)

Parents defending their children from fucked up, Marxist ideology are in it for "The Profits".

/rollseyes

https://twitter.com/EpochTimes/status/1524028990310256642

The Biden administration’s #DisinformationGovernanceBoard czarina, Nina Jankowicz, says that #Parents who are upset about #CriticalRaceTheory in public schools are “disinformers” who “weaponize” the issue “for profit.”

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

9aafcb  No.16247580

File: 77347cc5242d28e⋯.jpg (214.65 KB, 650x940, 65:94, 1fb11aae133b27bdaef3b0c0b3….jpg)

>>16247530

It is watered by the blood of slogans, fertilized with the manure of catchphrases and cried about by single purpose bots who until yesterday served Del Taco ads on GETTR and Twad. Newfags welcome.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

b0af5d  No.16247581

Ankle bracelets are a bitch

>>16247572

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

b0aad6  No.16247584

File: e9cdde569dc2e79⋯.jpg (315.98 KB, 1000x810, 100:81, The_Flying_Jazz_Kitten_bbs.jpg)

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

a1c6db  No.16247585

HQRRY MQRRY HQW NQW BRQWN CQW WQW ZQQM BRQQM MQQBZz MQQBIEZz ZQQMIE ZQQMZz SMQQSHA TQQSH FLUFFA PQQF EYEzZ TinkTINK Chu Pretty N CQQ

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

27b85a  No.16247586

File: 351e597098e1c17⋯.jpeg (27.32 KB, 255x255, 1:1, 1c1593984289d8a319c3b5479….jpeg)

>>16247556

that is my question too. Got to have one passing through the front office part for 15 seconds, but open-mouthed for an hour …."that is the only way we can operate" she said. well, this is the only way i can operate; against tyranny…it is a principle thing, and i wouldn't expect them to get it ; I can see at a hospital….but not the dentist. (they have the whole 'you-ain't a real doctor' chip on their shoulders )

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

0bad47  No.16247587

>>16247572

>>16247572

Perverted Prince Charles killed Diana so he could be with Camilla Bowels…… Loser

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

e24a5d  No.16247588

>>16247179

#20552

>>16247187 Ukraine Ops Report

>>16247233 New documentary PANDAMNED

>>16247235, >>16247305, >>16247327 @DineshDSouza Chief Justice Roberts in a 2018 opinion: “When the Government tracks the location of a cell phone, it achieves near perfect surveillance

>>16247239 Partial DS List

>>16247258, >>16247312 Scholars Question Mehmet Oz’s Justification for Maintaining Turkish Citizenship

>>16247263, >>16247273 Meme OPERATION: Save Your Rights (#Nebraska && W VA)

>>16247275 DAILY CHECKOFF ROUTINE

>>16247282 Democrats’ Bill to Codify ‘Roe’ and Abortion Omits the Word ‘Woman’

>>16247298 Fauci Rails Against the ‘Normalization of Untruths’ in Commencement Speech

>>16247314 Lori Lightfoot Call to Arms (Inciting Violence?)

>>16247323 Fort Lee Drill Sergeant Fired After Arrest in Underage Prostitution Sting Operation

>>16247332 PAT44 USAF G5 departed JBA ne

>>16247336 Pennsylvania Senate Poll: Dr. Oz Narrowly Leads Three-Way Race

>>16247359 5 Radical Facts About Incoming White House Press Secretary Karine

>>16247361, >>16247385 Durham/Sussman in the news

>>16247377 HUNTER BIDEN OIL RIG???

>>16247402 BLM Co-Founder Admits She Used Group’s $6 Million Property to Host Personal Parties

>>16247417 Lori Lightfoot: $500,000 in Funding for Abortions for Non-Chicagoans Is ‘a Down Payment

>>16247429 NATO state labels Russia ‘supporter of terrorism’

>>16247437 Europe-Med activity Starting over Israel

>>16247454 Civilians killed in Donetsk shelling?

>>16247482, >>16247486, >>16247490 The Swamp Today

>>16247506 PDJT: Nebraska && W Virginia , #Govote today for Charles W. Herbster and Alex Mooney

>>16247531 PF housekeeping The Italian AF AC (IAM3121 Falcon 900) that landed yesterday was not Super Mario Draghi

>>16247543 PF report Bun

BAKER NOTABLE

>anything to add anons?

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

a1c6db  No.16247589

>>16247585

WHQ LETzz That ugh mang ugh i show you once i show you twice ugh feathers every where stoopit stoopit duck llama arse dammmmmesarecute TQQT SCARE😳🌪💨YQU ALL GQNNA DIIIE HQKAY EYE LIES LIES SPITZztf✨

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

0bad47  No.16247590

File: 763fdf8ef5a744f⋯.jpg (62.19 KB, 553x487, 553:487, 6fcw1n_1.jpg)

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

a1c6db  No.16247591

>>16247589

YA LL MUH SINZz BEEZze REEEEEEDEEEMEEEEEEE DED ❗️ Q BULL DURHAM NUMBA QNE FIVE FIVE NINER SIX NINER TWQ DELTA FQUR FORE TQQ 143 BB✨

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

a1c6db  No.16247592

>>16247591

JQURNEY QNE FQRE QNE I N F I N I T Y TQQTHATWQ LQQKEYEZzFRENZz MUHTQQTZzCHQQCHQQ

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

241014  No.16247593

>>16247251

Its kinda funny how desperate they are, they think taking a video down is gonna prevent people from waking up. Google is losing their disinfo war. The more they do this, the more people question why

Trump cannot be taken down, God chose him, and God is greater than Google and all other social media companies, mega corporations etc

NCSWIC

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

a1c6db  No.16247594

>>16247592

GEWD LQRT C’MERE KEEP AMERICA GREAT AGAIN AGAIN TRUMPETTE2Q22 SHRUGZz HUGZz TREE CHU SQQN MQAR CRQTCH RQQM EYEZz NUBS CHU BUNNAY QN MQQN SQQN

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

27b85a  No.16247595

File: 7809a7e5a70c541⋯.jpg (14.52 KB, 227x255, 227:255, getting_shilly_in_here.jpg)

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

b959ee  No.16247596

File: efe82c5cd59ab35⋯.png (1.99 MB, 1247x935, 1247:935, 1652192181809.png)

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

a1c6db  No.16247597

>>16247594

QH NQQQQSsEYEzzETSsIZzAH WAH CHU GAWD EYEzzTQLL 🍪 FQRE CHU MiMiMiMiMiiiiiii iii 😠❗️ DQQR ugh 🚪 there

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

778aae  No.16247599

>>16247579

Projection.

Communists OWN COUNTRY CURRENCIES.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

e5b9ed  No.16247601

>>16247482

Well that is a lot of Globalist Meetings for this week. The amount of Jet Fuel consumed alone by all the faggot participants has furthered global air pollution by at least 100 metric tons.

Want to save the World, get rid of these faggots and their organizations, go back to sustainable permaculture and ancient water capture systems that the cabal knowingly wrecked over the last century. Hey Chile, Those holes on your mountains were to capture moisture so your underground rivers don't dry up. Those ancient Aliens were us assholes on History channel, before the cabal ended up during the last showdown destroying the world and our technology base.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

a1c6db  No.16247602

>>16247599

MAGALICIQUSTEETEETWQPATRIQTSFIGHTTQQMIDNIGHTRIDERz

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

9a39eb  No.16247603

File: e58d1a96e359b25⋯.jpg (5.21 MB, 5470x3647, 5470:3647, curious_kids_just_how_huge….jpg)

May God protect you w/ throngs of angelic protection, raise a standard and hedge of protection around Our chilldren and Our family, and an orb a light as protection from darkness and evil, and another lager orb around the sector, to brighten the

way forward. Holy Spirit, keep us suited up w/ the armour of God and pls anoint the planet and Milky Way with your holy spirit.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

9aafcb  No.16247604

File: 7c83a1be56b10e8⋯.jpg (47.4 KB, 452x679, 452:679, 7c83a1be56b10e868b5bb03361….jpg)

>>16247578

notable

Non Shill post appear on QR first in days.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

5f214a  No.16247605

File: ffab0948021a770⋯.png (341.73 KB, 1366x629, 1366:629, ClipboardImage.png)

>>16247558

https://www.dhs.gov/sites/default/files/publications/2020-hqfo-00934_-_records.pdf

Palantir Gotham

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

112eda  No.16247606

>>16247588

can take this out

>>16247543

had a dupe and you've got them on own

ty

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

a1c6db  No.16247607

>>16247602

ACHQQQQ

WHO Q

DAT CHU

YOU WHO DAT CAT

DIS IZz WHQDAT

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

b0aad6  No.16247609

File: 26c54b2d971ce50⋯.jpg (105.26 KB, 823x680, 823:680, billgates.jpg)

>>16247579

> Nina Jankowicz, says

Fuck what this lunatic says.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

8800a9  No.16247610

YouTube embed. Click thumbnail to play.

>>16247179

o7

< Spring

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

18150a  No.16247611

>>16247573

You think she's on ice waiting for a big distraction needed?

I do.

God take the Queen!

Brit new cry.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

0bad47  No.16247612

>>16247603

>>16247603

Did you see the milky way video from Mars?

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

b0af5d  No.16247613

File: f842c3c5e5748d1⋯.jpg (85.17 KB, 665x446, 665:446, Screenshot_20220509_210013….jpg)

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

54d19b  No.16247614

>>16247492

Look who is on the Board of Medical schools.

Which med. school candidates are chosen and why?

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

1328bf  No.16247615

File: 86d56456b0cde0f⋯.jpeg (180.89 KB, 1080x1407, 360:469, 2vzZMWT5v8FPd5cn5mCN_10_3….jpeg)

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

c61150  No.16247616

>>16247306

White people do civilized societies. The most tribalism you'll get is red versus blue.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

a82769  No.16247618

>>16247611

I think that everything is preplanned

Timing is everything and all

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

eeabdc  No.16247619

>>16247547

>Like, how far does it have to go to get to that 94-96% number?

We sure it wasn't "4-6% lost forever" on vaccines?

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

1328bf  No.16247621

File: d574bc9798e956a⋯.jpeg (163.85 KB, 1170x668, 585:334, nACDPTIjoCQGDUFBTlYp_10_a….jpeg)

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

54d19b  No.16247622

>>16247306

What happened to the idea that Trumpers are all a bunch of dumb redneck hicks? The Deplorable dregs of society?

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

007b01  No.16247623

File: 7c7db106b87a8e6⋯.jpg (17.47 KB, 416x262, 208:131, buy_large_mansions.jpg)

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

9a39eb  No.16247624

File: 6e2e08ecc9e1b7f⋯.jpg (131.25 KB, 1200x1329, 400:443, Screenshot_20210806_083956….jpg)

File: 6e39c6bb6a714c8⋯.jpg (67.47 KB, 651x326, 651:326, Screenshot_20210806_083906….jpg)

File: 6420d4c5b495773⋯.jpg (55.59 KB, 613x323, 613:323, Screenshot_20210806_083926….jpg)

>>16247605

>>16247570

>>16247558

Q!

is this relevant?

At In-Q-Tel, Painter’s work focused on identifying, researching and evaluating “new start-up technology firms that were believed to offer tremendous value to the CIA, the National Geospatial-Intelligence Agency, and the Defense Intelligence Agency.” Indeed, the NGA had confirmed that its intelligence obtained via Keyhole was used by the NSA to support US operations in Iraq from 2003 onwards.

A former US Army special operations intelligence officer, Painter’s new job at Google as of July 2005 was federal manager of what Keyhole was to become: Google Earth Enterprise. By 2007, Painter had become Google’s federal chief technologist.

‘TK’ refers to Talent/Keyhole, code names for imagery from reconnaissance aircraft and spy satellites,

https://www.iqt.org/portfolio/

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

bd648b  No.16247625

File: 068de1d9d5bcf3b⋯.jpg (43.58 KB, 640x480, 4:3, Karine_Jean_Pierre_640x480….jpg)

USA MAGA PATRIOTS

Once you reach the bottom there is only one way to go and that is up.

Lesbian Black African Negroid Cesspool is the bottom.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

27eca7  No.16247626

File: 1f1d306490ce7ba⋯.jpg (21.44 KB, 255x254, 255:254, HB_armorofgod2.jpg)

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

b0aad6  No.16247627

File: d60e44dda6a8e4a⋯.gif (134.44 KB, 374x335, 374:335, withthisonetrick.gif)

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

cde5a3  No.16247628

File: 4430d2489ad443f⋯.jpeg (383.83 KB, 960x1411, 960:1411, 72587A6C_B609_491F_BED8_C….jpeg)

File: 4f39a44c86d2006⋯.jpeg (137.37 KB, 896x552, 112:69, F69ED508_DCA6_40B9_B9B6_6….jpeg)

Weird Yellow Brick Road Found in Pacific Ocean

https://www.cnet.com/science/scientists-spot-weird-yellow-brick-road-in-pacific-ocean/

>Yellow Brick Road

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

9aafcb  No.16247629

File: 327ada54d3dcd04⋯.png (120.38 KB, 431x625, 431:625, ClipboardImage.png)

File: 434c6140f36834e⋯.png (681 KB, 625x452, 625:452, ClipboardImage.png)

"brief information on Alice Liddell (above photo taken by Carroll [back in those days, they could get away with public pedophilia which this image is not, Queen Victoria even ordered some for Prince Albert.]) and how Alice in Wonderland was allegedly created: "On 4 July 1862, in a rowing boat travelling on The Isis from Folly Bridge, Oxford to Godstow for a picnic outing, 10-year-old Alice asked Charles Dodgson (More commonly known by his pen name, Lewis Carroll) to entertain her and her sisters, Edith (age 8) and Lorina (age 13), with a story. As the Reverend Robinson Duckworth rowed the boat, Dodgson regaled the girls with fantastic stories of a girl, named Alice, and her adventures after she fell into a rabbit-hole. The story was not unlike those Dodgson had spun for the sisters before, but this time Alice asked Mr. Dodgson to write it down for her. He promised to do so but did not get around to the task for some months. He eventually presented Alice with the manuscript of Alice's Adventures Under Ground in November 1864." Now obviously most of that is the kind of typical myth given to the public to make them feel at ease (Peter Pan creator J. M. Barrie would be another example of this kind of thing I think), I feel we know enough to be able to read into it. Considering the themes of dissociation/confusion and many other psychological/MK aspects involved in child abuse that are present in Alice in Wonderland… it really isn't brain surgery to figure out what's going on here! Anyone expecting some kind of definitive proof either way is kidding themselves, there's a reason why those pages from his diary went missing, why Alice's mother tore up all the letters

from Dodgson to Alice, and I am sure most of Dodgson's more explicit photographs and drawings of naked little girls have been kept successfully buried."

"Alice is on the right, her sisters Edith and Irena (middle) are with them. Alice's MK/abuse probably started with her Oxford University Vice-Chancellor father Henry Liddell, who was also the Dean of Christ Church (Carroll met the family as Henry had just become the Dean of Christ Church) and he probably allowed her to be used by people like the aforementioned Reverend Robinson Duckworth (was a chaplain/member of the Order of St. John, with it's Maltese style cross always used by the powers that be, also a member of 'elite' Gentlemens clubs like the Athenaeum Club) who rowed the boat [this nursery ryhmne was probably sung in their "entertaining" of the girls: "Row, row, row your boat, gently down the stream. Merrily, merrily, merrily, merrily life is but a dream." (more dissociation ((don't worry about the abuse, just keep rowing (((keep following the white rabbit, keep following the yellow brick road etc etc)))… it's all just a dream anyway, in MK this is partly how dissociation is used; dreams, fantasy and reality are confused)), nursery ryhmnes/fairy tales are all full of it)]. Showing some more of Robinson's 'elite'/monarch connections, he served as Instructor and Governor to Prince Leopold (leopard; suffered from hemophilia [as most of the ibred royal scum did] and "mild epilepsy"), who more than likely used the Liddell sisters (again showing how these slaves are often used by 'elite'/royalty; Daisy Greville was another one [who then became King Edward VII's mistress, and was used by various "powerful men"]), Alice named one of her son's after the Prince and he was also the child's godfather (both her son's died in the mass ritual blood-sacrifice at WW1), Robinson became King Edward's Ordinary-in-Chaplain, then Queen Victoria's (you'll notice Monarch, Queen Victoria's painting featuring prominently in the Through The Looking Glass video further up). Like the occultist author of The Wizard of Oz Frank Baum, Lewis Carroll was also a member of/or at least influenced by the Theosophical Society.""

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

83625a  No.16247630

kek,2000 mules

Here is my idea, really crazy idea…

you make "2000 mules" go viral, when they question you, you say "I know it is true because I'm one of the mules"…

They can't question you because they would have to admit that they believe you.

Those that do believe you will help spread the word.

Now, whether you are a mule or not, just saying you're a mule will help with the story, let them use their resources to check out the story, when they do…they will know for a FACT that it is true.

They can't disprove it or the truth will come out.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

241014  No.16247631

File: 18f4351c218924e⋯.jpeg (291.49 KB, 1241x1436, 1241:1436, 69624C3E_B59B_4874_8A0C_3….jpeg)

Thank God Kristi Noem is being exposed

https://twitter.com/RMConservative/status/1524019946346496000?s=20&t=3OW2-yGgGQcu5s9B96KjMg

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

ea584d  No.16247633

>>16247411

worthless fucking holier than thou high horse sitting hypocrites blinded by your stupid ass dogmas

no wonder it's all but slowed to a crawl

>they want you divided by religion

<but it's totally okay when we do it

no wonder most oldfags said fuck this place

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

112eda  No.16247634

File: bf693028ba36935⋯.png (345.09 KB, 530x371, 10:7, ClipboardImage.png)

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

49ca64  No.16247635

Racyst shills are the flavor of the day. Their desperation and stupidity makes me smile.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

9aafcb  No.16247636

File: e17b0b3abdd5f04⋯.png (1.03 MB, 959x1350, 959:1350, ClipboardImage.png)

File: 28be6e16ada91ac⋯.png (1.46 MB, 833x1042, 833:1042, ClipboardImage.png)

File: a2820db1f8208cc⋯.png (668.04 KB, 625x469, 625:469, ClipboardImage.png)

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

181e21  No.16247637

File: 0b49325d07bc06f⋯.png (668.52 KB, 600x436, 150:109, ClipboardImage.png)

File: f38c4cae069e60a⋯.png (503.12 KB, 595x440, 119:88, ClipboardImage.png)

>>16247613

Kek!

Things are truly tough all over

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

eeabdc  No.16247638

>>16247628

Anything Wizard related is astral based right?

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

835c8d  No.16247639

>>16247290

With today's gas prices? Hell no! The only tax dollars we need to spend on these criminals is the cost of 1 bullet each.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

0dbcae  No.16247640

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

54d19b  No.16247641

>>16247417

Too bad her mother didn't abort her.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

778aae  No.16247642

File: b4e1514c0a69ae7⋯.png (70.66 KB, 678x621, 226:207, ClipboardImage.png)

File: 6f4f953b80d42f5⋯.png (1.15 MB, 1151x1270, 1151:1270, PedoSwitch.PNG)

Critical Race Theory disinformers accuse opponents of Critical Race Theory of being disinformers.

Head of DHS Disinformation Governance Board called opponents of critical race theory 'disinformers'.

Anon is staring evil right in its eye.

The dialectic of 'information and disinformation' according to the radical left allegedly describes everything they say is true on the one hand, and everything that is inconsistent with it is 'dis' information.

That dialectic of 'everything consistent with our introduction of division and inconsistencies is information, everything inconsistent with with our introduction of division and inconsistencies is disinformation.

This is the dialectic inversion (projection) that is being weaponized every day BY THE SOURCE OF THAT DIALECTIC OF DIVISION IN THE FIRST PLACE.

To teach polylogism to children is literally teaching them to regard their own inner selves as split and divided, the person they are as an individual, but they are brainwashed into believing there is another self in them, one that is supposed to speak and think according to their own race.

Racists like this board chief are PROJECTING their own racism and inconsistencies on the rest of the world.

https://justthenews.com/government/federal-agencies/head-dhs-disinformation-board-called-opponents-critical-race-theory

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

b0af5d  No.16247643

File: 3d56c7023954d91⋯.jpg (228.86 KB, 720x1310, 72:131, Screenshot_20220510_102604….jpg)

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

9a39eb  No.16247644

>>1624761

post it, pls/ ty.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

22dd31  No.16247645

File: 9b57738acf2426a⋯.png (396.79 KB, 841x691, 841:691, ClipboardImage.png)

>>16247639

Make Sri Lanka Great Again!

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

0cb70c  No.16247646

File: 681587bb0433378⋯.png (623.05 KB, 868x488, 217:122, ClipboardImage.png)

>>16247628

From article

The path to the Emerald City might travel along the ocean's bottom. The crew of the Exploration Vessel Nautilus caught sight of a strange-looking formation while studying an area called Liliʻuokalani Ridge in the Papahānaumokuakea Marine National Monument in the Pacific Ocean.

The feature resembles a road paved in cobblestones. Impressed researchers viewing live dive footage of the formation described it as a "yellow brick road" and "the road to Atlantis," and called it bizarre, cool and crazy in a video released last month.

Nautilus spent most of April studying the geology and biological systems of seamounts, underwater mountains with volcanic origins. "At the summit of Nootka Seamount, the team spotted a 'dried lake bed' formation, now ID'ed as a fractured flow of hyaloclastite rock (a volcanic rock formed in high-energy eruptions where many rock fragments settle to the seabed)," the team said. The brick-like patterns likely come from heating and cooling cycles connected to eruptions.

The exploration vessel is operated by the nonprofit Ocean Exploration Trust, which livestreams the ship's adventures, giving viewers a firsthand look at what its remote-operated diving vehicles see in the deep.

Nautilus has recorded all sorts of beautiful and unusual sea life, including cute dumbo octopuses and an oddball gelatinous creature from earlier this year. The Wizard of Oz-esque formation highlights how these ocean explorations can shed light on processes that are normally hidden away under the waves. Follow the yellow brick road to a greater understanding of seabed geology.

https://youtu.be/TID2kc8yb9Q

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

d24bf4  No.16247647

>>16247630

#RealMule

#Muletoo

#IMule

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

3ba9c0  No.16247649

File: c259774200012e2⋯.jpg (62.81 KB, 750x492, 125:82, sdfvsdfygsbfdgbfvd.jpg)

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

22dd31  No.16247650

File: 5625531574576b0⋯.png (537.42 KB, 1333x922, 1333:922, ClipboardImage.png)

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

b0aad6  No.16247651

File: 4a38ba803744ad6⋯.png (305.55 KB, 855x436, 855:436, ClipboardImage.png)

https://www.bitchute.com/embed/XBHOjFwefUlQ/

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

22dd31  No.16247652

File: 5fdad11d2cc7d58⋯.png (677.12 KB, 1333x659, 1333:659, ClipboardImage.png)

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

e24a5d  No.16247653

MT [GREEN] goes to court.

Trump has rallies in [GREEN]burg [GREEN]wood.

Spoopy time shift -Q (Flash) poster arrives on kun calling out mossad

USMC verifies Lightning (Flash) twice.

Russia Calls completion of Ukraine.

ANONS WE HAVE REACHED THE PRECIPICE

>prove me wrong

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

e5b9ed  No.16247654

>>16247497

>EXPLAIN WHY YOU DIDN'T STOP THE RIOTING???..NO EXCUSES!!!

Occurred in democrat run towns, cities, states. The democrat political leadership seized facist control with Antifa and BLM; POTUS-45 acted as an actual Federal President should by calling out the States and Local governments

>EXPLAIN WHY THE TRUTH HASN'T COME OUT ON…..9/11, BENGHAZI, COVID-19, ETC….???

We the people let them continue to lie because we accepted a two party system that has locked the truth away. There is only Power now, there are no differences

>WHY DOES THE GOVERNMENT LIE ALL THE TIME, INCLUDING, GOVERNORS, MAYORS, CONGRESS MEMBERS, DOJ/FBI/CIA.ETC…???……WHY????

The Uni-Party owns them all with blackmail or enrichment, families hostage or willing thugs to further the Power Structure

>WHEN WILL IT…..STOP????????

When everyone wakes up to the rigged system and realizes that we the people have the Power. This is what our Founding Revolution showed us, it is not by might of arms alone, but by the Faith and Integrity and Goodness of the People that victory is won.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

5f214a  No.16247655

File: 03673d0d8b1f902⋯.png (322.38 KB, 1366x629, 1366:629, ClipboardImage.png)

>>16247558

"FALCON (which is HSI's customized version of Palantir Gotham, a COTS software product)

provides HSl's agents and analysts with a key investigative resource: a wholly integrated,

consolidated platform performing federated search, analytics,geospatial referencing, reporting

and situational awareness capabilities across a broadly diverse universe of structured and

unstructured law enforcement data residing in numerous, disparate source environments.

https://epic.org/wp-content/uploads/foia/dhs/ice/palantir-databases/EPIC-17-08-14-ICE-FOIA-20190606-Supplemental-Production.pdf

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

241014  No.16247656

File: 33e1b84a225a4f5⋯.jpeg (339.9 KB, 934x1315, 934:1315, 37B97F4E_D371_43F8_BEE2_C….jpeg)

>>16247631

From the article:

On paper, Democrats are an endangered species in the Mount Rushmore State. Not a single labeled Democrat holds a state office. Republicans control the state Senate 32-3 and the state House 62-8. Sounds like a conservative paradise, right? Well, as it relates to abortion and guns, like most other red states, the politics reflects the political orientation of the majority of the people. Other issues? Democrats as may as well hold a super-majority, particularly in the Senate. They just run as Republicans.

In that vein, it was shocking to read how Governor Kristi Noem has declared war, not on the RINOs who legislate like Democrats, but on the few House Republicans who actually want to make the state distinct from a blue state. Last week, the Argus Leader reported that Noem is taking a “hands on” role in training candidates to run for legislature, including those challenging the few conservative incumbents.

Not seen as vulnerable in her primary, Noem says she's still not taking her party's nomination for governor for granted. But she is managing to find time to involve herself in some battleground legislative contests. She's offered candidate school seminars to up-and-coming politicians, making endorsements and even going as far as publicly chastising Republican incumbents she doesn't see eye to eye with politically.

Last month, for instance, Noem joined District 4 House candidate Stephanie Sauder on a radio program where she openly accused Rep. Fred Deutsch, R-Florence, of being a poor legislator doing damage to South Dakota's way of life.

According to the Argus Leader, the governor is also working with Sen. Lee Schoenbeck, the president pro tempore, “to unseat far-right members of the party seeking re-election.”

Here is a list of targeted races based on a paper circulated by Schoenbeck referenced in the Argus Leader:

The highlighted members are the establishment picks not deemed “far right.”

But what does “far right” mean? People who oppose men in female sports, chemical castration of minors, corporations violating human rights and mandating dangerous shots, but support reduced taxes? The aforementioned issues have essentially been the dividing lines between the governor and some of the House conservatives over the past two years. These members were pushing for a half-percent reduction in the sales tax, but were stymied by the governor. Then they tried to eliminate the sales tax on food and institute a gas tax holiday, something done even in some blue states. Yet the governor evidently opposes it enough to primary them out of office.

Conservatives in the state and nationwide clashed with Governor Noem last year when she opposed the bill barring men in female sports.

“All of the people on her target list are true Christian conservatives, and those are the people she wants gone,” said Rep. Rhonda Milstead, the lead sponsor of HB 1217, the female sports bill, in an interview with TheBlaze.

Milstead also accuses the GOP establishment of targeting the most conservative members with new districting maps. “Our redistricting was awful because it put the people they want out in districts where they will have a hard time, or they placed solidly conservative people against each other in the same district,” charged the freshman, who represents the greater Sioux Falls area. Milstead claims the map was drawn with the intent of placing several other conservatives into her district.

Fred Deutsch of Watertown was placed into a new district because he was viewed as more repugnant to the GOP establishment than Joe Biden and the Democrats. His crime was the sponsoring of a bill banning chemical castration for minors, a bill that easily passed in numerous other red states. Yet this year, South Dakota failed to pass a single meaningful bill on any important issue, from transgenderism and illegal immigration to medical freedom and COVID fascism.

In an interview on KXLG in Watertown on April 21, Kristi Noem, who hails from that part of the state, lambasted Deutsch and others for being a drag on the state and sloppy legislators who don’t read bills and understand the consequences of good governance. “We need people who are thoughtful,” said Noem in a common refrain we hear from establishment Republicans…

https://www.theblaze.com/op-ed/horowitz-why-is-governor-kristi-noem-attacking-the-small-group-of-conservative-south-dakota-legislators

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

778aae  No.16247657

>>16247650

These sick fucks are PREYING ON THE IGNORANCE OF THEIR OWN VOTERS

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

5c562a  No.16247658

File: 5b09ab5b0560754⋯.jpg (8.44 KB, 229x220, 229:220, smokingpepe2.jpg)

What kind of swampy cesspool did I wade into, Q?! For fuck's sake. Flak when over the target, yada yada yada, I know, but still. I want two postcards now. It's a nice break from this place and the scenery, while infinitely more vapid, is beautiful and that is only skin deep on many. Back I go.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

eeabdc  No.16247659

>>16247646

>>16247628

>>16247643

It's light, but feels slightly noteable

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

1328bf  No.16247660

>>16247628

Atlantis was destroyed.

Trump has the weapon that did that.

Hydrosonics are more then just a super cavitating torpedo that can travel at mach speeds.

Can dematerialize a civilization off the map like it never even existed.

Makes sense why no one fucks with the Maestro now?

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

a82769  No.16247661

>>16247633

You're not wrong.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

9f3ead  No.16247662

File: f7ecd0d75bbf799⋯.png (179.23 KB, 591x594, 197:198, ClipboardImage.png)

File: 31b4c17d387d595⋯.mp4 (696.44 KB, 520x270, 52:27, oz.mp4)

>>16247628

https://twitter.com/Adige78Aslan/status/1523950660504412161

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

9aafcb  No.16247663

File: 94bbbecd4507169⋯.png (606.15 KB, 625x469, 625:469, ClipboardImage.png)

File: 5deebec6d0f60fa⋯.png (641.88 KB, 625x469, 625:469, ClipboardImage.png)

File: e457ba8f3af1608⋯.png (634.42 KB, 625x469, 625:469, ClipboardImage.png)

File: 760d9954183d3b0⋯.png (230.92 KB, 423x373, 423:373, ClipboardImage.png)

File: 1342dd75dc5633b⋯.png (1.6 MB, 669x1025, 669:1025, ClipboardImage.png)

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

b0af5d  No.16247664

File: cfe6126b640b54a⋯.jpg (11.5 KB, 255x143, 255:143, 183ef8c0e1534bc2118598b645….jpg)

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

54d19b  No.16247665

File: c9d17012dc50e5c⋯.png (410.93 KB, 577x433, 577:433, ClipboardImage.png)

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

18150a  No.16247666

File: 88bdd005b564948⋯.png (829.09 KB, 735x948, 245:316, f88d1c0d3cb9cebeb4dc6d5312….png)

>>16247580

Typical of some here miss the meme through the fodder.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

e5b9ed  No.16247667

>>16247631

The cabal deploys their minions and hostages everywhere. Minions have no political party, they are wolves in sheeps clothing. Hostages are compromised by blackmail or hostage to money or fear of family. She is one of the above and has always been. Always fear the showmanship politician.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

0cb70c  No.16247668

File: 26aa8e163421f9c⋯.png (109.36 KB, 290x216, 145:108, ClipboardImage.png)

>>16247659

Guess we're off to see the Wizard then

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

8fa33e  No.16247671

File: 2927e73eb1a5401⋯.png (186.59 KB, 494x264, 247:132, uc6UZeI.png)

>>16247662

>strange 'Yellow Brick Path'

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

9aafcb  No.16247672

File: bbc7c42b0a39ae1⋯.png (398.16 KB, 487x485, 487:485, ClipboardImage.png)

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

8800a9  No.16247673

>>16247628

NOTABLE 'OZ' COMM

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

22dd31  No.16247674

File: 52f325803f765da⋯.png (2.54 MB, 1242x1375, 1242:1375, ClipboardImage.png)

File: 2a94542818f1ec0⋯.png (312.98 KB, 1242x1389, 414:463, ClipboardImage.png)

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

778aae  No.16247675

>>16247653

Statements are not proved right in the present just because such statements when made logically precede all other contingent statements such as those consisting of 'disproofs'.

It would be like emailing a person at 11pm at night and then immediately publishing a hit piece that includes a further smear 'our wrap up smear target did not comment on this story'.

No statement is proved true by an absence of a dialectic contradictory statement to it.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

241014  No.16247676

File: 7dcc4e27500e1f9⋯.jpeg (392.2 KB, 1241x1846, 1241:1846, 73174699_A1A2_4654_84E5_C….jpeg)

A new business lobby backed by Republican heavyweights is looking to build clout with GOP leaders amid high-profile splits between the party's policymakers and key segments of corporate America, Axios has learned.

Why it matters: The American Free Enterprise Chamber of Commerce is positioning itself as an alternative to groups such as the U.S. Chamber of Commerce. The new group's backers complain the Chamber has lurched left from its onetime post at the vanguard of a Republican-aligned political apparatus.

The chairman of the AmFree chamber, as it's known internally, is Terry Branstad — the former Republican governor of Iowa and President Trump's ambassador to China.

Its CEO is Gentry Collins, a former political director of the Republican National Committee.

The AmFree Chamber will provide an avenue for American businesses looking to influence Republicans, who appear poised to retake congressional majorities next year.

What's happening: The new chamber's formation comes as corporate America grapples with increasing pressure to engage on issues such as voting rights, racial justice and abortion — and the potential political fallout from doing so.

"I hope to make the case to our policymakers at all levels that we must move away from the trend towards socialism and back to a pro-business, pro-growth posture," Branstad told business leaders during a conference call last Thursday, which Axios also attended.

In a memo pitching the group to potential members, a copy of which was obtained by Axios, the AmFree Chamber offers "tools for American businesses to maintain access to the marketplace in the face of 'woke capital' and 'cancel-culture' threats," among other benefits.

The big picture: A high-profile split last year between the U.S. Chamber and congressional Republicans — including House Minority Leader Kevin McCarthy, the potential next Speaker — provides a lane for a group that can effectively wield influence among GOP leaders, say sources close to the project.

"The void that is filled is [the AmFree Chamber] isn’t dead to Hill Republicans who will likely control the floor of both House and Senate" next year, one Republican lobbyist told Axios.

A senior House leadership aide told Axios the U.S. Chamber has "become more interested in electing so-called pro-business Democrats who vote for their party’s decidedly anti-business, woke agenda."

"It’s no surprise Governor Branstad and others have recognized this and are stepping in to fill this void," the aide said.

What they're saying: "[W]e warmly welcome anyone who joins our agenda, advocating for businesses and their workers. We need the pro-business voices to be heard loud and clear," a U.S. Chamber spokesperson told Axios.

The group "has worked with our network of state and local chambers across the country to secure important legislation, benefiting businesses of all sizes and our country as a whole," the spokesperson said, citing its work on trade, inflation, infrastructure and "the threat of government overreach."

"To find viable solutions, we need to collaborate and work with all stakeholders."

Between the lines: Multiple sources close to the new Branstad group used the term "woke" to describe the U.S. Chamber, a social-justice buzzword that's been relegated largely to the domain of conservative critics.

One source pointed to the group's engagement on ESG, or environmental, social and corporate governance business practices, and positions on tech sector regulation at odds with Republican critics of the industry.

Another brought up its preservation of scaffolding on its Lafayette Square headquarters covered by graffiti and artwork during 2020's Black Lives Matter protests.

While candidates still regularly tout the endorsements from the chamber and its state affiliates, it's become a political epithet in some high-profile Republican primary contests.

How we got here: The last time a Democratic president faced his first midterm election, the Chamber was a Republican-aligned powerhouse.

At this point in the 2010 cycle, it had reported more than $30 million in independent political spending, according to OpenSecrets data.

So far this cycle, it's reported a little more than $200,000, though the group says that's largely due to a shift toward political tactics such as digital ads that don't require reports to the Federal Election Commission.

It's also spending huge sums on its Washington lobbying operation and has maintained a steady pace of contributions to federal political candidates.

It's some of those past contributions — to Democrats in competitive races last cycle — that helped drive a wedge between the group and key Republican leaders such as McCarthy.

https://www.axios.com/2022/05/10/gop-anti-woke-chamber-lobby

https://twitter.com/Surabees/status/1523989695692222464?s=20&t=3OW2-yGgGQcu5s9B96KjMg

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

7a62cd  No.16247678

File: 377bb0ad5d6b3b1⋯.png (134.73 KB, 255x247, 255:247, ClipboardImage.png)

File: e8a4ec40471fb15⋯.png (111.93 KB, 255x241, 255:241, ClipboardImage.png)

File: 8dc63400b36f130⋯.png (52.72 KB, 225x255, 15:17, ClipboardImage.png)

File: 8cb179437858926⋯.png (105.41 KB, 224x255, 224:255, ClipboardImage.png)

File: 9bbe7ad5a631ebb⋯.png (115.33 KB, 249x255, 83:85, ClipboardImage.png)

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

e83c83  No.16247679

File: fbeb5cd91c3733a⋯.png (51.83 KB, 810x542, 405:271, 115.png)

SNOW WHITE

GODFATHER III

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

1328bf  No.16247680

File: a6f1ae4ab980115⋯.png (379.17 KB, 535x557, 535:557, Capture.PNG)

During Operation Lethal Eagle II

@101CAB

worked closely with

@TheRakkasans

,

@101stAASLTDIV

to conduct a large scale air assault operation on Fort Knox, Ky.

#Readiness #StrongerTogether

@18airbornecorps

@USArmy

https://twitter.com/FORSCOM/status/1523996273459744768

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

c61150  No.16247681

>>16247636

First pic is fake

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

1f4106  No.16247682

File: 1ccb97832b0c849⋯.jpg (117.86 KB, 975x657, 325:219, vfdfvd.JPG)

>>16247312

another hospital system EXACT same message….

https://www.slhn.org/blog/2022/important-message-regarding-global-shortage-of-contrast-media-for-scans

Important Message Regarding Global Shortage of Contrast Media for Scans

May 06, 2022

Dear St. Luke’s Patients,

Due to unprecedented COVID-related supply chain disruptions in China, all hospitals in the United States are experiencing a shortage of contrast media (sometimes referred to as X-ray dye) used to perform CAT or CT scans. As at all U.S. hospitals, St. Luke’s ability to perform these scans in all but the most critical cases will be limited until these supply chain issues are corrected. This shortage has been caused by the Chinese government’s COVID lockdown of Shanghai, where most of the world’s supply of contrast media is manufactured and then subsequently distributed by GE Healthcare and Bracco. This disruption is expected to last until at least the end of June.

St. Luke’s is exploring various strategies to conserve contrast media, including using other imaging technologies and materials and postponing non-emergency scans. As always, we are 100% committed to providing the best possible care to our patients. We will continue to keep you informed about this issue. If you have any questions or concerns, please call us at 1-866-STLUKES, option 2.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

7a62cd  No.16247683

File: 0310e66caef49d3⋯.png (113.33 KB, 255x241, 255:241, ClipboardImage.png)

File: 0310e66caef49d3⋯.png (113.33 KB, 255x241, 255:241, ClipboardImage.png)

File: 0310e66caef49d3⋯.png (113.33 KB, 255x241, 255:241, ClipboardImage.png)

File: 0310e66caef49d3⋯.png (113.33 KB, 255x241, 255:241, ClipboardImage.png)

File: 0310e66caef49d3⋯.png (113.33 KB, 255x241, 255:241, ClipboardImage.png)

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

22dd31  No.16247684

>>16247671

stopping only for a night in the poppy fields

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

e24a5d  No.16247685

>>16247675

so thats a no 'i cant prove you wrong' in bloated dialect noted

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

c21bad  No.16247686

File: b9c75c8317e971f⋯.png (135.13 KB, 255x247, 255:247, ClipboardImage.png)

File: b9c75c8317e971f⋯.png (135.13 KB, 255x247, 255:247, ClipboardImage.png)

File: b9c75c8317e971f⋯.png (135.13 KB, 255x247, 255:247, ClipboardImage.png)

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

007b01  No.16247687

File: 1008850020a929f⋯.mp4 (3.66 MB, 1280x720, 16:9, Trump_I_Will_Never_Forgive….mp4)

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

9aafcb  No.16247688

File: 3700f1092cf14bb⋯.png (2.17 MB, 975x1000, 39:40, ClipboardImage.png)

File: 6a5c3372c1ca119⋯.png (2.61 MB, 882x1350, 49:75, ClipboardImage.png)

MM falls asleep reading Through the Looking Glass and he leaves his body or dissociates; the sleeping/dreaming is always symbolic dissociation not a literal standard dream, victims are taught to believe their abuse was a 'dream' (which is easy to do because the victim's dissociative mind will automatically want to think that it wasn't real as a survival mechanism; most "dreams" are quickly forgotten) MICKEY, like victims of CIA’s Monarch mind control program, which grew out of MK Ultra MICKEY goes 'Thru the Mirror' where everything is backwards/mirrored, and all of the inanimate objects become animated and alive, which is obviously a common theme in Disney films.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

c21bad  No.16247689

File: db7edd50f0945c7⋯.png (106.4 KB, 224x255, 224:255, ClipboardImage.png)

File: db7edd50f0945c7⋯.png (106.4 KB, 224x255, 224:255, ClipboardImage.png)

File: db7edd50f0945c7⋯.png (106.4 KB, 224x255, 224:255, ClipboardImage.png)

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

54d19b  No.16247690

>>16247417

Anyone who gets an abortion should get their tubes tied at the same time.

A twofer.

You can get an abortion, but then you must have your tubes tied as well.

Seems fair.

One chance to kill an unborn baby is all a woman gets.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

3ba9c0  No.16247691

YouTube embed. Click thumbnail to play.

LIVE: DNI Haines Testifies on Global Threats

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

e83c83  No.16247692

>>16247680

KEK

Fort Knox you say?

GOLDCOMMS

KEK

Nothing to see here, carry on

o7

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

22dd31  No.16247693

>>16247653

>>prove me wrong

>>16247675

>>prove me wrong

prove me wrong is a leftie argument used when no facts support the assertion

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

ea584d  No.16247694

>>16247661

all empires fall sooner or later

so too will this one

and i will have no sympathy because ultimately, people get what they deserve

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

b0aad6  No.16247695

File: c1c39be5e31c9e4⋯.png (5.79 KB, 46x46, 1:1, ClipboardImage.png)

>>16247691

(hand fart)

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

d033e1  No.16247696

>>16247258

>>16247276

>>16247283

>>16247287

>>16247312

>>16247588

If Turkish dual citizenship is a problem (foreign agent), are the 40+ Jewish dual passport holders in Congress (foreign agents) a problem?

5d Chess - Let Trump be Trump and SUPPORT HIM

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

85bc47  No.16247697

can somebody repost the John Roberts opinion on geofencing please?

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

8800a9  No.16247698

Bitchute embed. Click thumbnail to play.

>>16247692

>GOLDCOMMS

: War-Castles &: Russell-Jay: Gould.

https://www.bitchute.com/video/myfUhOhpgvQK/

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

241014  No.16247699

File: 7da78b0c54d5fb6⋯.jpeg (299.96 KB, 1194x2140, 597:1070, 3F0E817E_3DD1_4B00_895F_1….jpeg)

The Narrative is not going to workgiven so mamy people know the media lies constantly. They will try but after Russia, Russia, Russia they have been exposed and Durham is putting a stake in the heart of the vampire media

https://twitter.com/bhweingarten/status/1524020993408307200?s=20&t=3OW2-yGgGQcu5s9B96KjMg

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

22dd31  No.16247701

File: 0b00b624a226de7⋯.png (821.14 KB, 1333x1281, 1333:1281, ClipboardImage.png)

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

241014  No.16247703

File: 502543a1d097418⋯.jpeg (160.41 KB, 1241x702, 1241:702, E1BA2432_85DF_4085_B926_E….jpeg)

https://twitter.com/DonaldJTrumpJr/status/1524020227176079361?s=20&t=3OW2-yGgGQcu5s9B96KjMg

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

b0aad6  No.16247704

>>16247698

why don't you search nano gold?

https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4101904/

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

8d2bdb  No.16247705

File: e03b16848c79b87⋯.jpg (45.01 KB, 750x413, 750:413, 6fm2ks_1.jpg)

Pure evil raises it's ugly head again.

https://www.thegatewaypundit.com/2022/05/moment-call-arms-chicago-mayor-lightfoot-calls-insurrection/

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

241014  No.16247706

File: 76d5f60159ad390⋯.jpeg (315.88 KB, 1241x1516, 1241:1516, 8C0F8E77_2751_4CE5_8E89_3….jpeg)

Good for Hawley, but too many Congress people are owned by Disney

https://twitter.com/HawleyMO/status/1524013754333159424?s=20&t=3OW2-yGgGQcu5s9B96KjMg

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

a82769  No.16247707

>>16247694

>people get what they deserve

That's simply not true

The world isn't fair

And it is filled with chaos

The most "fair-minded" people do evil when they try to make the world fair

Babies don't "deserve" to starve to death

Children don't "deserve" to die from vaccine induced diseases

Bill Gates doesn't "deserve" billions of dollars from his crony-corruption scheme

The Vatican doesn't "deserve" the billions it sits on derived from it's corrupt pyramid scheme

But you're right, empires do fall, eventually

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

c8e3cd  No.16247708

>>16247226

Everyone is a Joo but you. You lost. They all converted. You are are greatly outnumbered.

KYS

I'll have you buried in a black neighborhood in Haifa

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

e0487e  No.16247709

File: c08574394b939be⋯.png (73.71 KB, 574x864, 287:432, ClipboardImage.png)

>>16247619

Um. No. As a matter of fact, the vaccines/virus don't seem to have made much of a dent in anything.

https://www.macrotrends.net/countries/WLD/world/death-rate

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

b0aad6  No.16247710

File: 39123d3d3e8c090⋯.png (501.32 KB, 908x761, 908:761, ClipboardImage.png)

NABU NABU NANO NANO

Nano Gold

Nano Gold

Nano Gold

http://www.ncbi.nlm.nih.gov/pmc/articles/PMC4101904/

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

1328bf  No.16247711

File: f21f5647d962330⋯.png (530.92 KB, 533x556, 533:556, Capture.PNG)

Dreams don’t work unless you do. 💯

#FiresStrong #TeamSill #ArmyValues

@USArmy

@TRADOC

https://twitter.com/OfficialFtSill/status/1524011384060751873

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

e24a5d  No.16247712

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

c8e3cd  No.16247714

File: 823bd60db8a8a8e⋯.jpeg (801.34 KB, 1280x670, 128:67, and_you_still_don_t_trust….jpeg)

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

22dd31  No.16247715

File: 5c87f09a708e2ae⋯.png (516.61 KB, 893x698, 893:698, ClipboardImage.png)

File: d226dadb05ed0d9⋯.png (712.55 KB, 888x783, 296:261, ClipboardImage.png)

HOLY SHIT MARIA!

when did she become a hung over meth head?

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

861563  No.16247716

>>16247667

>>>16247631

>

>The cabal deploys their minions and hostages everywhere. Minions have no political party, they are wolves in sheeps clothing. Hostages are compromised by blackmail or hostage to money or fear of family. She is one of the above and has always been. Always fear the showmanship politician.

Now fast forward and think what it would be like if the DS ever succeeds in obtaining term limits.

Think Strategically, the only thing helped by term limits would be the DS.

Constantly we hear the misinformed cry for term limits to be codified into law.

The Powers That Be (PTB) desperately want to have term limits codified into law. This would make their planning and execution of their take over agenda so much easier and their goals obtainable on a much more orderly schedule.

If only they could have clarity that every political candidate would expire on a defined term, they could plan the identification and grooming of a string of appropriately compliant (i.e. corrupted and/or blackmailed) candidates to meet each future election without having to expend any effort to destroy the candidacy of any true patriotic, organic, statesman/woman that the populace might have elected. They could/would, years in advance, create favorable impressions in the public subconciense of their desired candidates for the next election cycle(s) well before their last minion's term was up. No organic citizen trying to run for the RIGHT reasons would stand a chance against the deliberately crafted paragons of manufactured virtue that the PTB had, months/years earlier, carefully branded and packaged in preparation for the next election cycle. They would be shoe-ins and completely unaccountable to the electorate.

Bottom line is we ALREADY HAVE term limits dammit…it's called VOTING. What actually needs to be codified into law are mechanisms to ensure that voting is free of fraud. For example: voter ID, one day voting, no universal mail-in votes, highly restricted absentee ballots with stringent signature verification, etc.

If, by chance, we DO get a genuinely good person into a position of power, I want them to stay their to do good work…and to be responsible to the electorate if they don't. Not be arbitrarily term limited out so a hand crafted minion can take their place and further the agenda of the PTB.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

c8e3cd  No.16247717

File: 1c18ba9e09fb948⋯.jpeg (691.9 KB, 1280x763, 1280:763, if_your_not_pregnant.jpeg)

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

54d19b  No.16247718

>>16247630

2000 mules will show the world that the Judicial System is corrupt to the core and nothing will be done about voter fraud.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

5e6878  No.16247719

File: a3b9d1b73949e39⋯.png (827.79 KB, 1362x499, 1362:499, ClipboardImage.png)

SOUTH DAKOTA ANONS GET THIS ON SOCIAL MEDIA

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

c3403b  No.16247720

File: 8dc63400b36f130⋯.png (52.72 KB, 225x255, 15:17, ClipboardImage.png)

File: 8dc63400b36f130⋯.png (52.72 KB, 225x255, 15:17, ClipboardImage.png)

File: 8dc63400b36f130⋯.png (52.72 KB, 225x255, 15:17, ClipboardImage.png)

File: 8dc63400b36f130⋯.png (52.72 KB, 225x255, 15:17, ClipboardImage.png)

File: 8dc63400b36f130⋯.png (52.72 KB, 225x255, 15:17, ClipboardImage.png)

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

b0aad6  No.16247721

>>16247711

Army isn't strong when they are Sick with HIV.

Army isn't dependable when they drop from MyoCardititus.

Army isn't WISE when they live short lives.

Army didn't protect us from Domestic and foreign enemies.

DEFUND ARMY

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

a599ef  No.16247722

File: 538bee86a3fff81⋯.png (444.62 KB, 800x1280, 5:8, Screenshot_20220510_104306.png)

File: a081b592ba80333⋯.png (476.92 KB, 800x1280, 5:8, Screenshot_20220510_104245.png)

File: 650085412024a95⋯.png (388.61 KB, 800x1280, 5:8, Screenshot_20220510_104255.png)

File: 4af4dee0b67244a⋯.png (321.06 KB, 800x1280, 5:8, Screenshot_20220510_104300….png)

Look how long I had to scroll to find the title of the movie/film/video.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

b7b94f  No.16247723

File: 427b98c1f1a79e8⋯.jpeg (302.8 KB, 2160x2700, 4:5, 1C330D93_4E0A_4DD4_9088_7….jpeg)

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

c3403b  No.16247724

File: 9bbe7ad5a631ebb⋯.png (115.33 KB, 249x255, 83:85, ClipboardImage.png)

File: 9bbe7ad5a631ebb⋯.png (115.33 KB, 249x255, 83:85, ClipboardImage.png)

File: 9bbe7ad5a631ebb⋯.png (115.33 KB, 249x255, 83:85, ClipboardImage.png)

File: 9bbe7ad5a631ebb⋯.png (115.33 KB, 249x255, 83:85, ClipboardImage.png)

File: 9bbe7ad5a631ebb⋯.png (115.33 KB, 249x255, 83:85, ClipboardImage.png)

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

187b59  No.16247725

How are the normiesstillasleep? With all of the bombs/bombshells that have been dropped they still haven’t awoken? Did someone put Propofol in the chemtrails? Why can’t they wake up? What has been done to them?

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

1f4106  No.16247726

>>16247682

>Bracco

https://www.bracco.com/en/group

The Group

Bracco is an international Group active in the healthcare sector and a leader in diagnostic imaging. It has around 3,587 employees and annual total consolidated revenues of around 1,4 billion euros, 89% of which from international sales.In the Research and Development area, the company invests approximately 10% of reference turnover in the imaging diagnostics and medical devices sectors and has a portfolio comprising over 2,000 patents.PRODUCT PORTFOLIOThe Group’s main products are contrast agents, medical substances used to improve the diagnostic accuracy of biomedical imaging and the care of patients affected by diseases of varying type and severity. Contrast agents are routinely and widely used in all diagnostic imaging modalities, such as radiographic procedures, including computed tomography (CT), magnetic resonance imaging (MRI), ultrasound and nuclear medicine.GLOBAL COMMERCIAL PRESENCEBracco contrast media are sold in over 100 countries, both directly and indirectly through branches, joint ventures and licence and distribution agreements. Thanks to the quality and reliability of its products, the Group boasts leading positions in the most important geographical areas such as North America, China, Europe and Japan.RESEARCH AND INNOVATION IN DNAResearch and Development activities are concentrated in the laboratories in Geneva and Lausanne (Switzerland), Monroe and Silicon Valley (United States) and Italy (Colleretto Giacosa). Each research centre has specialised experience and expertise at the absolute cutting edge in different imaging modalities and operates in synergy with the medical and regulatory departments, whose operations are located in Milan (Italy), Konstanz (Germany), Paris (France), Monroe and Long Island (United States), Montreal (Canada), Mexico City (Mexico), São Paulo (Brazil), Beijing (China), and Tokyo (Japan).THE PRODUCTION ACTIVITIESThanks to constant investment in operating processes, Bracco has reached levels of excellence in quality, in full compliance with all applicable regulations in every country where it operates, and with special attention paid to ecologically sustainable production. The production activities of Bracco Imaging are carried out in Italy (Ceriano Laghetto, Torviscosa and Colleretto Giacosa), Canada (Montreal), Switzerland (Geneva), Germany (Singen), Japan (Saitama) and China (Shanghai).

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

b0af5d  No.16247727

File: 4ec6e49a9275ac4⋯.jpg (72.63 KB, 500x823, 500:823, 6fm4nq.jpg)

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

5e4600  No.16247728

File: de2f1bed9a3f3c4⋯.jpg (141.27 KB, 1280x720, 16:9, IMG_20220510_094615_716.jpg)

CIA WEAPONIZED AGAINST THE PUBLIC IN THE U.S. & WORLD.

From: Andrew Zebrun the 3rd

The United States Needs The Truckers More Than Ever

Autobots Transform And Roll Out.

https://rumble.com/v145jvc-cia-weaponized-against-the-public-in-the-u.s.-and-world.html

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

c8e3cd  No.16247729

File: 823bd60db8a8a8e⋯.jpeg (801.34 KB, 1280x670, 128:67, and_you_still_don_t_trust….jpeg)

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

c8e3cd  No.16247730

File: 5adebd48ce8d991⋯.jpeg (276.29 KB, 750x618, 125:103, _cause_you_gave_up_your_r….jpeg)

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

b0af5d  No.16247731

2000 mules on bannon today

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

18150a  No.16247732

>>16247672

Those boys look so sad in 5he meme.

When was it taken? 2014?

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

3e27ef  No.16247733

File: eb5172f0bd57b9d⋯.png (95.49 KB, 182x255, 182:255, ClipboardImage.png)

File: eb5172f0bd57b9d⋯.png (95.49 KB, 182x255, 182:255, ClipboardImage.png)

File: eb5172f0bd57b9d⋯.png (95.49 KB, 182x255, 182:255, ClipboardImage.png)

File: eb5172f0bd57b9d⋯.png (95.49 KB, 182x255, 182:255, ClipboardImage.png)

File: eb5172f0bd57b9d⋯.png (95.49 KB, 182x255, 182:255, ClipboardImage.png)

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

22dd31  No.16247734

>>16247712

not an argument

nobody even reads the BS when its says prove me wrong

santa & jesus are real

>prove me wrong

jfk jr is alive

>prove me wrong

earth is flat

>prove me wrong

RRN is REAL

>prove me wrong

jews did it

>prove me wrong

youre a daily shill

>prove me wrong

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

10c9e3  No.16247735

File: 91f6fb415337128⋯.jpeg (952.88 KB, 1125x2039, 1125:2039, 80D36505_09AA_4C3D_A820_C….jpeg)

Looks like someone decided to do the right thing. Must have seen the movie.

https://twitter.com/foxla/status/1523883056100257793?s=21&t=ktUYAN7_HMmQBq6GO3Msdw

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

54d19b  No.16247736

>>16247719

It's RINO not RHINO

Republican In Name Only

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

982cd6  No.16247737

File: 99af26d7e83ca50⋯.jpg (75.5 KB, 500x526, 250:263, 6du32i_1.jpg)

File: f44a2150cdf72f1⋯.jpg (89.71 KB, 500x570, 50:57, DarkTrace.jpg)

Politicians like Mitch McConnell, Nancy Pelosi, Susan Collins and Joe Biden them days are rapidly coming to an abrupt end and America is moving on and must after the 2020 stolen elections that have taken America down a very dark road.

America needs technology experts as state Representatives that can't be fooled by anyone in Washington DC especially the DEEP STATE GATEKEEPERS.

Ron Watkins is not a politician and he brings honesty and the whole technology enchilada to the table.

Seriously I haven't seen anyone in the election stealing state of Arizona running for Congress that can meet the technology challenges ARIZONA is facing other than Ron Watkins.

Ron Watkins goes to Washington DC and writes a few complex algorithm codes and search's the government servers just watch all the criminality in Washington DC that is made available to the public…. Legislative branch judiciary branch and the executive branch have all left huge paper trails of corruption that the Deep State gatekeepers continue to keep hidden from the American people…

We all need to see that stuff.

DARK TRACE IS THE MOST COMPLEX ALGORITHM CODE EVER DEVELOPED PERIOD AND UNLEASHED ON GOVERNMENT SERVERS AI TECHNOLOGY WILL NOT LEAVE ANYTHING BEHIND…. If your name is in that algorithm just hope you are not a dirt bag anti American criminal.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

45a03a  No.16247738

File: a1d797e3768c336⋯.png (35.91 KB, 319x390, 319:390, neverforgive.png)

File: e40805259a01a90⋯.png (139.25 KB, 348x728, 87:182, neverforgive1.png)

>>16247687

I'll never forgive him for what he did,

in many other ways,

which I'll talk to you about in the future

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

27eca7  No.16247739

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

778aae  No.16247740

>>16247712

>>16247693

>>16247685

>so thats a no 'i cant prove you wrong' in bloated dialect noted

Kek, I am describing your own self imposed dialectic ruleset to you.

Your latest statement is just a looping error of the same dialectic code I just described to you.

Your narrative is itself a reflection of a split 'personality' syntax structure where you're imagining anyone else to be 'doing anything' that allegedly justifies and proves your own statements true.

A statement from source A is not proved true from any objective 'not just A's own beliefs' standard by back referencing another statement from A.

You're just looping on yourself, and that is why Anons can predict your next smear.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

b0af5d  No.16247741

>>16247715

She always looks like she had to service a few gatekeepers before hitting the air.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

e5b9ed  No.16247742

>>16247587

Much Worse than that anon, Diana was raped by Phillip, since England would not accept the Habsberg as King wed to Elizabeth, They waited a generation. Why do you think William looks more like Phillip than Charles ? Diana knew she was a broodmare chosen for blood. After William, they didn't give two fucks who she partnered with in private. Only after she divorced Charles, did it become an issue. She thought the smitten Saud could protect her, (foolish girl). Charles is infertile, So screwing his cousin Camilla doesn't matter. He will never be king, William is the chosen heir. Harry finally learned his paternity and was paid out of the royal cadet line, meant to challenge fraudeau for rulership of the maple leaf.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

3ba9c0  No.16247743

Senator Tuberville: Do you believe Russia blames us, our intelligence agency, for Ukraine shooting down a plane with hundreds of troops aboard?

Director Haines: I don't know.

Tuberville: Do you believe that Russia blames U.S. Intelligence for sinking their flagship, Moskva?

Haines: I don't know.

Tuberville: You believe that they are fighting us as well as they are fighting Ukraine?

Haines: In a sense. Their perception.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

c8e3cd  No.16247744

File: 0dc295bed92989e⋯.jpeg (593.22 KB, 1280x1190, 128:119, Open_your_mouth_pissboy.jpeg)

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

405100  No.16247745

>>16247737

your shit sucks and is nothing but spam

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

007b01  No.16247746

File: 5b4071f39861024⋯.png (2.5 MB, 1500x1925, 60:77, comfy_dog.png)

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

a1c6db  No.16247747

>>16247607

HQNK FQRE CurvZZZSs MAGICALI DELLEYEMQAR AGAIN ❗️ #FJB dANGERQUSs KEK CONTANK R USA QH BEBEST GQ HAY HQ MISTA BILL YAYQ DEALIN RED PILLZz 💊 MAKE AMERICA GREAT AGAIN AGAIN DQLLA RQLLZz PURE GQLD 💰✨

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

5e6878  No.16247748

>>16247736

COFFEE PLEASE THANKS BROTHA

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

b0aad6  No.16247749

DEFUND HOUSE, SENATE, SCOTUS, USPS, CISA, DOMINION SOFTWARE SYSTEMS, ES&S, ARMY, CIA, NED, FREEDOM HOUSE, FBI, DOJ, SES, IG, JTF, DOD, DTRA, IIA, NATO, UN, WHO, CDC, NIH, Fauci, to pay for NAZIS IN UKRAINE

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

9f814e  No.16247750

File: d89b02ebdfbe782⋯.png (197.9 KB, 461x504, 461:504, ClipboardImage.png)

>>16247553

don't forget this one.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

3ba9c0  No.16247751

Tuberville: We could guarantee that the First Lady was safe when she went to Ukraine?

General Berrier: I would not say that.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

173df4  No.16247752

>>16247633

>no wonder most oldfags said fuck this place

did they, though, or are they laughing at you silently?

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

b0aad6  No.16247753

File: e0f6ec4ceacd013⋯.jpg (274.37 KB, 1600x892, 400:223, Gowdy_flyer.jpg)

Defund the Federal Reserve

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

d15616  No.16247754

>>16247445

well they haven't had people pushing at 'em.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

345719  No.16247755

File: d94ad6579595f09⋯.png (343.17 KB, 588x500, 147:125, fauci_new_variant.png)

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

bdd963  No.16247756

>>16247725

What's been done to the normies is a SIN. What's been done to all of us the world over is a SIN.

Mass manipulation of minds is a SIN.

We've been victimized since the CIA shot Kennedy.

The heart of evil has been beating in DC and SINNING in our name since before Kennedy.

Just because we refuse to step up and reclaim the helm of our ship will not save us from going down with it.

Seek God. Choose not to lie. Pray your asses off.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

1f4106  No.16247757

>>16247730

support your slavery or expose it. two different paths.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

22dd31  No.16247758

>>16247740

tl;dr bieber

you are fail

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

173df4  No.16247759

>>16247653

>Spoopy time shift -Q (Flash) poster arrives on kun calling out mossad

>

>USMC verifies Lightning (Flash) twice.

it's a hopeless slide

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

49b901  No.16247760

File: 22ed34b4dc72b64⋯.png (318.54 KB, 711x719, 711:719, 33_22_69.png)

>>16247460

You guys like to call 17 the "Star of the Magi"

We know, and it's really tedious.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

241014  No.16247761

File: 237a9b7d27b2f03⋯.jpeg (198.97 KB, 1241x1318, 1241:1318, DB362F9E_4C66_4EFD_8E37_9….jpeg)

File: beb6377aec73a55⋯.jpeg (172.54 KB, 1160x1713, 1160:1713, 6DAB3BF9_8EB4_41D6_9FFA_6….jpeg)

File: a218d212b48441e⋯.jpeg (192.08 KB, 1106x1650, 553:825, 5744201F_9EC4_4913_8A60_2….jpeg)

File: 70e35cd8f0e0946⋯.jpeg (217.25 KB, 1241x2106, 1241:2106, 5A7C1B92_EA33_4F2B_A939_A….jpeg)

File: 94120e304c7ea73⋯.jpeg (272.35 KB, 1186x2473, 1186:2473, E562979A_7A42_4757_A3FE_9….jpeg)

Open Secrets how many Congress invested in Disney

How much Disney gave to congress pacs

How much Disney spent in lobbying in 2020

Good for Hawley, but too many Congress people are owned by Disney

https://www.opensecrets.org/orgs/walt-disney-co/recipients?id=D000000128

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

e24a5d  No.16247762

Hundreds Arrested In Massive Child Porn Investigation, Exposing International Network Of Abuse

https://dailycaller.com/2022/03/03/child-porn-investigation-new-zealand-eu-europol/

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

b0af5d  No.16247763

>>16247752

But mules gotta mule

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

c8e3cd  No.16247764

File: c00267fdc1e11e9⋯.jpeg (1.3 MB, 1280x1239, 1280:1239, The_Waco_compound_was_woo….jpeg)

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

1328bf  No.16247765

Does anyone here think Ukrainian troops have any ability to move anywhere within Ukraine without Russian forces being aware of it?

They are stuck in the tunnels, the exits have been shut.

Does anyone believe the weapons and supplies that we are sending to Ukraine are getting into Azov hands?

FUCK NO

This is another deal Trump made with Russia.

Just as Barak armed the goat fuckers, Trump is arming the new alliance.

The Afghanistan SNAFU… nicely blamed on Biden.

There is a war coming, and we'll be ready.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

10c9e3  No.16247766

>>16247753

****Amen

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

e24a5d  No.16247767

BREAKING: Vicky White, who allegedly facilitated jailbreak of Alabama inmate, is dead, officials say -

https://twitter.com/Breaking911/status/1523830329869488131

UPDATE: Fugitive Casey White is in custody and Vicky White has died from a self-inflicted gunshot wound, officials say. The manhunt ended after a police chase that ended in a rollover crash.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

5daf87  No.16247768

>>16247752

we are still here laughing

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

22dd31  No.16247769

File: 3e7d39ee82935f8⋯.png (879.97 KB, 1333x683, 1333:683, ClipboardImage.png)

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

b0aad6  No.16247770

File: 7311ae49d6a6eb5⋯.jpeg (108.34 KB, 1280x856, 160:107, FSXrNsiWQAEpQ9O.jpeg)

>>16247760

it's all so dotardsome

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

982cd6  No.16247771

File: 4e88d29c2787fe5⋯.jpg (101.63 KB, 500x752, 125:188, 4e88d29c2787fe595aaeb53913….jpg)

File: a2196d3e86629ba⋯.jpg (81.46 KB, 500x562, 250:281, 6chuo.jpg)

>>16247745

You sir are a jealous fool with no skin in the game…. RON WATKINS CodeMonkey is known WORLDWIDE and you are a nobody PEDOPHILE….. lmao

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

5e4600  No.16247772

File: 2b481eaa53cfd27⋯.mp4 (6.47 MB, 360x360, 1:1, VID_20220510_095259_461.mp4)

Stress release…

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

e24a5d  No.16247773

“Cellphone data is like digital DNA,” Engelbrecht explained. A court case on the precision of this technology makes that claim difficult to dispute. In response to the 2016 Supreme Court case, Carpenter v. United States, Justice Roberts wrote a 2018 opinion in which he describes the level of precision tracing afforded by pinging a cellphone using geofencing technology. “Accordingly, when the Government tracks the location of a cell phone,” writes Roberts, “It achieves near perfect surveillance as if it had attached an ankle monitor to the phone’s user.” Two of the most striking paragraphs from his 2018 opinion are captured below:

https://casetext.com/case/carpenter-v-united-states-67

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

d15616  No.16247774

>>16247547

Some are already saying the 2000 Mules was fabricated.

they are deep-under in hypnosis

With the right cue (Q?) they could be out with the snap of the fingers.

It only takes an instant to wake up.

anon assumes different people will have different paths to the wake-up moment

Then you have people who don't want to wake-up

It's their choice.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

e24a5d  No.16247775

The Missouri Senate on Monday passed an extensive election integrity bill.

The new law requires a photo ID for voting.

Senator Bob Onder announced on Facebook that the new election law bans drop boxes, ballot harvesting, and Zuckerbucks.

Missouri House Bill HB1878 was passed tonight by the Missouri State Senate.

The original text of the bill is here.

Senator Bob Onder broke the news this evening on Facebook.

https://www.thegatewaypundit.com/2022/05/breaking-missouri-senate-passes-election-integrity-bill-bans-drop-boxes-ballot-harvesting-zuckerbucks-requires-photo-voting/

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

22dd31  No.16247776

File: 548ef888a99cefb⋯.png (1.04 MB, 1333x734, 1333:734, ClipboardImage.png)

>>16247768

can confirm

laughing, much laughing

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

112eda  No.16247777

>>16247741

was sorta hot long ago

>not nao

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

241014  No.16247778

File: edbf83aceff2451⋯.jpeg (252.93 KB, 1241x888, 1241:888, B3F5AF2A_D911_41F1_B0F8_4….jpeg)

https://twitter.com/SteveDeaceShow/status/1524010792160534530?s=20&t=3OW2-yGgGQcu5s9B96KjMg

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

345719  No.16247779

File: 35562eeb52c4f64⋯.png (369.98 KB, 555x449, 555:449, Biden_truth_ministry.png)

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

5e6878  No.16247781

File: 6e1a6a8de11907f⋯.png (345.79 KB, 1051x499, 1051:499, ClipboardImage.png)

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

5fef26  No.16247782

File: 6bd4b21d21e1d95⋯.png (8 KB, 350x245, 10:7, Capture.PNG)

>>16247653

I can't prove it but I believe the precipice is still several months away. Avg Joe American is still to fat, happy and content to be bothered with paying attention to anything that is happening. The public is going to have to feel some real pain to snap out of their retardation.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

5f214a  No.16247783

>>16247697

https://www.lawfareblog.com/do-geofence-warrants-violate-fourth-amendment

Do Geofence Warrants Violate the Fourth Amendment?

The courthouse for the United States District Court Eastern District of Virginia in Richmond, where a Fourth Amendment challenge has been brought in U.S. v Chatrie.

Last year, a New York Times feature detailed law enforcement’s use of a new investigative technique called a geofence warrant. Unlike traditional warrants that identify a particular suspect in advance of a search, geofence warrants essentially allow the government to work backward. These warrants compel a technology company (so far, only Google) to disclose anonymized location records for any devices in a certain area during a specified time period. After that, for certain accounts, the government may obtain additional location data and subscriber information. Particularly in light of the Supreme Court’s watershed decision in Carpenter, geofence warrants present a host of novel Fourth Amendment issues.

https://casetext.com/case/carpenter-v-united-states-67

Chief Justice ROBERTS delivered the opinion of the Court.

This case presents the question whether the Government conducts a search under the Fourth Amendment when it accesses historical cell phone records that provide a comprehensive chronicle of the user's past movements.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

0dbcae  No.16247784

>>16247658

cardigan pepe' s other personality

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

2d83e4  No.16247785

>>16247579

>Nina Jankowicz, says that Parents who are upset about CriticalRaceTheory in public schools are “disinformers” who “weaponize” the issue “for profit.”

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

27eca7  No.16247786

File: 9a9706408592f0d⋯.jpg (173.66 KB, 564x830, 282:415, HB_Matthew2818.jpg)

File: 3539996504a9c3c⋯.jpeg (14.65 KB, 214x255, 214:255, holdtheline2.jpeg)

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

e24a5d  No.16247787

Nonprofit Watchdog Uncovers $350 Million in Secret Payments to Fauci, Collins, Others at NIH

https://resistthemainstream.org/nonprofit-watchdog-uncovers-350-million-in-secret-payments-to-fauci-collins-others-at-nih/?utm_source=telegram

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

b0af5d  No.16247788

>>16247765

God owns all hearts and is in complete control. False narrative are produced by false prophets.

Prayer has won.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

85bc47  No.16247789

>>16247738

Trump could have exposed 9/11

Trump could have declassified everything

Trump could have unleashed holy hell on the deep state

Trump could have called out COVID as Bullshit and stopped the money grab by big pharma

But he didn't and nothing happened. Now who is feeling the pain? $5 gas $6 milk, cost of living and cost of feeding your family sky rocketing. baby formula shortages, tax payer money flowing into the deep state haven of Ukraine, elections still not safe and secure…but yea, trust the plan anons

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

98a401  No.16247790

File: 03e3b1aefd91625⋯.jpg (40.47 KB, 500x498, 250:249, downloadfile_11_.jpg)

File: e8590bce57141eb⋯.jpg (130.5 KB, 889x500, 889:500, 6fgfo9.jpg)

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

18150a  No.16247791

>>16247725

They are in a containment box called corporate government media..

We're trying to breakout the political information prisoners currently.

Twitter will be a big factor by it being a core of information flows.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

27eca7  No.16247792

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

8800a9  No.16247793

>>16247721

>Army didn't protect us from Domestic and foreign enemies.

Those who would/can/will are flocking here. >>16247698

>>15897207 (OP)

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

c8e3cd  No.16247795

>>16247715

and a lard ass

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

345719  No.16247796

File: 74c8fc9b1d681ad⋯.png (369.41 KB, 720x405, 16:9, Biden_one_term.png)

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

e24a5d  No.16247797

Help keep voter rolls Accurate.

Join in a citizen-led effort to ensure the accuracy of our nation’s voter rolls using IV3.

IV3 is a web-based app that empowers voters with an automated way to confirm accuracy, identify ineligible records, report findings to local authorities, and stay up to date on the recent changes to your local voter rolls.

https://www.iv3.us/

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

e8e24c  No.16247798

File: 1376b822307459e⋯.png (256.35 KB, 683x457, 683:457, bidan.png)

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

c8e3cd  No.16247799

>>16247731

it was on my HD the day it was released

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

b0aad6  No.16247800

File: 983b51398e00ffc⋯.png (498.42 KB, 730x433, 730:433, ClipboardImage.png)

>>16247766

fund some hamburgers or something worth while

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

007b01  No.16247801

File: 2a30ffae7a0c370⋯.jpg (98 KB, 470x684, 235:342, 2_parties.jpg)

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

5e4600  No.16247802

File: f432f7cb11edadf⋯.jpg (156.68 KB, 1400x933, 1400:933, https_hypebeast_com_image_….jpg)

Andy Warhol's Marilyn Monroe Painting Goes to Auction For Estimated $200 Million USD

Shot Sage Blue Marilyn by Andy Warhol is being put up for auction by Christie’s New York this May. Its current estimated price is $200 million USD, and if realized will be the most expensive 20th-century artwork ever to sell at auction.

Warhol first began creating silkscreens of legendary American actress Marilyn Monroe following her death in August 1962 and would create reproductions of her visage multiple times in bright colors, often with the features somewhat askew.

https://hypebeast.com/2022/3/andy-warhol-marilyn-monroe-painting-estimated-200-million-usd-auction-news

>>16247786

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

b0af5d  No.16247803

Cynicism is shill jism.

And you're drunk on it for lack of discernment

Sad.

>>16247789

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

b0aad6  No.16247804

>>16247802

all modern art is shit

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

a82769  No.16247805

>>16247789

No, you have to let the C_A, the Mil, the DS, the MSM, the Globalists, the Bankers, the Churches, etc, continue their con for as long as they can get away with it so there isn't a sudden stop leading to massive devastation.

Sadly, even if that means casualties along the way.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

22dd31  No.16247806

File: 3299334ff3ab92e⋯.png (566.7 KB, 555x577, 555:577, ClipboardImage.png)

>>16247777

>was sorta hot long ago

like 2am hot?

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

1328bf  No.16247807

File: 9ee205c589bb731⋯.png (282.04 KB, 534x632, 267:316, Capture.PNG)

“Non nobis solum nati sumus.

(Not for ourselves alone are we born.)”

― Marcus Tullius Cicero

#MondayMotivation #BattleBuddy

https://twitter.com/RaiderBrigade/status/1523707160269824000

https://youtu.be/G2qIXXafxCQ

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

241014  No.16247808

File: 6547e634918fbf2⋯.jpeg (303.26 KB, 1241x1429, 1241:1429, A6B2FD2A_D2A8_440A_A89F_4….jpeg)

https://twitter.com/MZHemingway/status/1524010516334710784?s=20&t=3OW2-yGgGQcu5s9B96KjMg

The GOP Pawned Social Conservatism For The Economy And Got Neither

There’s a myth in Indianapolis Republican circles that goes something like this: back in the good old days, the Indiana GOP was made up of high-minded, moderate statesmen from metro Indianapolis like Richard Lugar and Bill Hudnut. Then a bunch of troglodytes from rural Indiana like Mike Pence took over and wrecked the party and state with extreme social conservative policies that are bad for business.

In terms of actual legislation enacted, Indiana is one of the least socially conservative red states. But the economic results have also been underwhelming to poor for the state and its people. The Indianapolis GOP elites and their truce both effectively disenfranchised and impoverished the state’s Republican voters, while the left, which never agreed to any part of a truce, made significant advances on its own social policy agenda in the state.

What Were the Results of the Truce?

I was a big Daniels supporter, and with the exception of a couple of policy points agreed with almost everything he did. I remain a great admirer of his. The idea of the truce, of trading social priorities for fiscal discipline and economic growth sounded reasonable on paper. But did it work?

Fiscally, it did. Indiana went from a budget deficit to a massive surplus and a AAA credit rating. It is one of the nation’s fiscally strongest states.

Economically, it was a complete failure. While the state has added population and jobs slightly faster than some other surrounding Rust Belt states, it has been a demographic and economic laggard. Much of the state is shrinking. Its job growth has trailed the nation.

Personal incomes fell from an already low level relative to the nation, making Hoosiers poorer. Wage growth has been nearly the lowest in the nation. Talent was not attracted to the state. In fact, during the 2010s Indiana suffered its worst decade in history for college degree attainment in terms of its performance versus the nation.

The share of high school grads going to college is in decline. Indiana has become a haven for low-wage employers. It is adding mostly jobs for workers with less than a high school diploma in a nation where most job growth has been among the college educated. Many of the state’s communities continued to physically decay. And social pathologies like opioid addiction exploded.

Indiana’s conservative voters traded away their social priorities, and in return simply put further behind economically and socially. Again, for them the truce was a double failure.

I don’t claim the truce caused bad economic results, or even that Republican leadership is the primary source. I think structural forces beyond the control of the state’s leaders were more decisive. But the truce certainly didn’t make a positive contribution to the economy.

Social Policy Does Not Determine Economic Growth or Talent Attraction

Indiana holds important lessons for both conservatives and liberals. For conservatives, it shows that the low taxes/low regulation/libertarianish economic policy approach does not always create growth and prosperity. For both liberals and conservatives, it shows that social policy has far less impact on talent attraction and economic growth than they commonly believe.

https://thefederalist.com/2022/05/09/indiana-republicans-pawned-social-conservatism-for-economic-growth-and-got-neither/

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

5e4600  No.16247809

File: 6a575b3b4ed3c41⋯.jpg (15.82 KB, 300x180, 5:3, sen_ron_johnson_300x180_Xj….jpg)

Sen. Ron Johnson Demands Answers From CDC Over Alleged Tracking of Americans During Pandemic

Sen. Ron Johnson (R-Wis.) has launched a probe into the Centers for Disease Control and Prevention (CDC) over its alleged tracking of millions of Americans during the COVID-19 pandemic.

In a letter sent to CDC Director Rochelle Walensky on May 5, Johnson questioned the agency’s alleged use of location data and demanded answers regarding why this was allowed and whether it is still ongoing.

“It remains unclear why the CDC tracked millions of Americans during the pandemic and whether it continues to do so. In response to COVID-19, the CDC should have been prioritizing the development of treatments, effective testing, and vaccine safety rather than tracking Americans’ daily lives,” Johnson wrote.

https://conservativevoicesusa.com/sen-ron-johnson-demands-answers-from-cdc-over-alleged-tracking-of-americans-during-pandemic/

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

d15616  No.16247810

File: 91d186f78f01112⋯.jpg (105.57 KB, 932x932, 1:1, psyoptrickers.jpg)

>>16247774

Whatever some of the trriggers for awakening are, there's bound to be some surprise.

Talk about waking "the Masses"

?

Taking back the power of the Electric Mass Media would do it.

Just emergency service on the cellphones? Might not be enough.

TeeVee, newspapers.

Anybody? type scenarios NOW

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

ea584d  No.16247811

File: b119498d037d527⋯.png (860.75 KB, 724x488, 181:122, ClipboardImage.png)

File: 9a4e4db8f42ad50⋯.png (294.37 KB, 500x373, 500:373, ClipboardImage.png)

File: c9e3c6508ba4989⋯.png (664.39 KB, 960x714, 160:119, ClipboardImage.png)

>>16247707

who enabled them to amass that wealth?

who works for the very companies that push all these globalist agendas?

who keeps buying stocks in the stock market so they can make a few bucks?

who keeps going to these dogma centers that are tax exempt through 501c3 and throwing in the collection plate on top of it?

back before all this and when tribalism was prevalent, communities looked after their own and band together when roads needed fixed or homes needed built - now there's a government entity to forcibly extract it from them to enrich themselves and send to other countries rather than helping those who truly need it but apparently it's communism to help out fellow countrymen and somehow it isn't to send to foreigners.

would bill gates have all his money if people didn't buy his products?

would babies starve had their family had the means to support it before having it?

who is ultimately responsible for allowing a needle to go in an arm? the person who wants to keep their paycheck working for that company? the parent who forces their kid because they were told to?

people are stuck in the 5 monkey experiment and the game of life.

it's okay for uncle sam to horde over 650 million acres of land in the united states but the average person should work themselves to the bone to afford a pod.

i just don't gaf anymore.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

70d622  No.16247812

File: 513c5109d645091⋯.jpg (555.62 KB, 1238x1167, 1238:1167, 20220223_194252.jpg)

>>16247777

Checked

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

241014  No.16247813

File: df12f907c4724b6⋯.jpeg (230.95 KB, 1241x950, 1241:950, D9D1D444_597E_4F53_95F4_2….jpeg)

Kathy Barnette

@Kathy4Truth

Too many on our side are worrying about being politically correct while the Left is spray painting churches, intimidating Supreme Court Justices and issuing “calls to arms”.

We are fighting for the soul of our nation here. Time to wake up, people!

https://twitter.com/Kathy4Truth/status/1524009689406652416?s=20&t=3OW2-yGgGQcu5s9B96KjMg

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

54d19b  No.16247814

>>16247688

Disney has always been Disturbed.

Fuck Disney.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

b0af5d  No.16247815

>>16247805

Maybe you two should get a room

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

007b01  No.16247816

File: 8583a02ffa353b4⋯.jpg (39.51 KB, 680x387, 680:387, ministry_of_truth_approved.jpg)

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

112eda  No.16247817

File: dc6203ed5d0fc09⋯.png (846.38 KB, 990x500, 99:50, ClipboardImage.png)

>>16247806

last call hot

kek

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

c8e3cd  No.16247818

>>16247757

more than 2 paths, loser

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

22dd31  No.16247819

File: ff6e2a2c59362e2⋯.png (1.12 MB, 1674x878, 837:439, ClipboardImage.png)

>>16247804

>all modern art is shit

the CIA has shape much of modern culture

from 1995-

Modern art was CIA 'weapon'

Revealed: how the spy agency used unwitting artists such as Pollock and de Kooning in a cultural Cold War

For decades in art circles it was either a rumour or a joke, but now it is confirmed as a fact. The Central Intelligence Agency used American modern art - including the works of such artists as Jackson Pollock, Robert Motherwell, Willem de Kooning and Mark Rothko - as a weapon in the Cold War. In the manner of a Renaissance prince - except that it acted secretly - the CIA fostered and promoted American Abstract Expressionist painting around the world for more than 20 years.

The connection is improbable. This was a period, in the 1950s and 1960s, when the great majority of Americans disliked or even despised modern art - President Truman summed up the popular view when he said: "If that's art, then I'm a Hottentot." As for the artists themselves, many were ex- communists barely acceptable in the America of the McCarthyite era, and certainly not the sort of people normally likely to receive US government backing.

https://www.independent.co.uk/news/world/modern-art-was-cia-weapon-1578808.html

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

54d19b  No.16247820

>>16247813

"They" want so badly for Conservatives to become violent.

It's much better to just use Passive Resistance.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

e8e24c  No.16247821

File: 8310262b72a8db7⋯.png (197.63 KB, 480x267, 160:89, 2022_05_10_11_06_38.png)

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

345719  No.16247822

File: ce0a56e27ee3ade⋯.png (1.23 MB, 1280x720, 16:9, ClipboardImage.png)

>>16247806

>>16247817

Beer Goggles hot

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

5e4600  No.16247823

File: 2f1421ab9948a9d⋯.mp4 (5.12 MB, 464x848, 29:53, VID_20220510_100602_305.mp4)

President putin on world wide hunger, and foiod shortages.

https://t.me/TrueWorldOrder/4056

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

18150a  No.16247824

File: bcb9651244fd460⋯.jpg (37.36 KB, 820x417, 820:417, IMG_20211020_075614_141.jpg)

>>16247730

More and more states are passing election laws.

These coming midterms are the most important time to stand up and vote.

Those like this poster are in panic that people will continue to vote.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

861563  No.16247825

>>16247804

>>>16247802

>

>all modern art is shit

money laundering

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

187b59  No.16247826

>>16247792

>pride

This is probably responsible for the lion’s share of the lack of awakening. As such, it’s not that the normies can’t awaken, it’s that they choose to keep their heads in the sand (or at least to maintain that appearance) because swallowing the red pill means swallowing their pride as well.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

e0487e  No.16247827

File: a1dcbd6c3d07ae6⋯.jpg (9.36 KB, 255x152, 255:152, What_s_in_your_precipice.jpg)

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

22dd31  No.16247828

File: 1bc3cda14952929⋯.png (1.62 MB, 1333x968, 1333:968, ClipboardImage.png)

>>16247813

yes,

we must remain passive

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

e24a5d  No.16247829

>>16247179

#20552

>>16247187 Ukraine Ops Report

>>16247233 New documentary PANDAMNED

>>16247235, >>16247305, >>16247327, >>16247773 @DineshDSouza Chief Justice Roberts in a 2018 opinion: “When the Government tracks the location of a cell phone, it achieves near perfect surveillance

>>16247239 Partial DS List

>>16247258, >>16247312 Scholars Question Mehmet Oz’s Justification for Maintaining Turkish Citizenship

>>16247263, >>16247273 Meme OPERATION: Save Your Rights (#Nebraska && W VA)

>>16247275 DAILY CHECKOFF ROUTINE

>>16247282 Democrats’ Bill to Codify ‘Roe’ and Abortion Omits the Word ‘Woman’

>>16247298 Fauci Rails Against the ‘Normalization of Untruths’ in Commencement Speech

>>16247314, >>16247813 Lori Lightfoot Call to Arms (Inciting Violence?)

>>16247323 Fort Lee Drill Sergeant Fired After Arrest in Underage Prostitution Sting Operation

>>16247332 PAT44 USAF G5 departed JBA ne

>>16247336 Pennsylvania Senate Poll: Dr. Oz Narrowly Leads Three-Way Race

>>16247359 5 Radical Facts About Incoming White House Press Secretary Karine

>>16247361, >>16247385 Durham/Sussman in the news

>>16247377 HUNTER BIDEN OIL RIG???

>>16247402 BLM Co-Founder Admits She Used Group’s $6 Million Property to Host Personal Parties

>>16247417 Lori Lightfoot: $500,000 in Funding for Abortions for Non-Chicagoans Is ‘a Down Payment

>>16247429 NATO state labels Russia ‘supporter of terrorism’

>>16247437 Europe-Med activity Starting over Israel

>>16247454 Civilians killed in Donetsk shelling?

>>16247482, >>16247486, >>16247490 The Swamp Today

>>16247506 PDJT: Nebraska && W Virginia , #Govote today for Charles W. Herbster and Alex Mooney

>>16247531 PF housekeeping The Italian AF AC (IAM3121 Falcon 900) that landed yesterday was not Super Mario Draghi

>>16247631 Kristi Noem called out on attacking S Dakota conservatives

>>16247653, >>16247782 Anon Opines - Have we reached the Precipice?

>>16247628, >>16247643, >>16247662, >>16247671 Weird Yellow Brick Road Found in Pacific Ocean (OZ Comms?)

>>16247680 @FORSCOM During Operation Lethal Eagle II @101CAB worked closely with @TheRakkasans

>>16247696 Anon has a Question - Are the 40+ Jewish dual passport holders in Congress (foreign agents) a problem?

>>16247703 DonaldJTrumpJr - You can't find baby formula (Baby Formula Vs Ukraine Support, who got the funding?)

>>16247706 Hawley on the heels of Disney (Copyright Protection)

>>16247711 @OfficialFtSill Dreams don’t work unless you do.

>>16247762 Hundreds Arrested In Massive Child Porn Investigation, Exposing International Network Of Abuse

>>16247775 Missouri Senate passes extensive election integrity bill.

>>16247787 Nonprofit Watchdog Uncovers $350 Million in Secret Payments to Fauci, Collins, Others at NIH

Closing in

>>16247797

>Help keep voter rolls Accurate. https://www.iv3.us/

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

eb8a34  No.16247830

>>16247825

>laundering

Yup, just ask expert finger painter, Hunter Biden

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

5e4600  No.16247831

File: 2f1421ab9948a9d⋯.mp4 (5.12 MB, 464x848, 29:53, VID_20220510_100602_305.mp4)

President putin on world wide hunger, and food shortages.

https://t.me/TrueWorldOrder/4056

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

778aae  No.16247832

>>16247758

Anons cracking the code and all they can do is reeeeeeeeeeee

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

345719  No.16247833

File: 71659a3e0062a61⋯.jpg (164.71 KB, 1792x1080, 224:135, Psaki_gaslight.jpg)

>>16247774

>Some are already saying the 2000 Mules was fabricated.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

c8e3cd  No.16247834

>>16247824

voter outcome will double, not be halved

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

7a451e  No.16247835

File: 505973e83847bce⋯.png (147.56 KB, 465x262, 465:262, 505973e83847bce713f9e9d931….png)

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

0b2d04  No.16247836

>>16247769

And yet no effective wall or fence to protect America from criminal invaders and terrorists.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

241014  No.16247837

Why Today’s Left Is Willing To Admit Abortion Kills A Child And Still Support It

BY: ELLE REYNOLDS MAY 10, 2022

If self-gratification is our highest good, then any act (up to and including the murder of a child) becomes good if done in its pursuit.

Any sinful culture — as all are between Eden and glory — might allow or excuse the killing of an innocent child.But the times such an act has been celebrated have historically been tied to religious rituals in which a child was sacrificed to a supposed deity. In our post-religious culture, that sacrifice is laid on the idol of self.

That self-obsession and self-worship help explain why the arguments for abortion have shifted from “safe, legal, and rare” to open fetishizing the deaths of babies.

“I’m killing the babies!” an activist in front of the Basilica of St. Patrick’s Old Cathedral in New York City screamed while wearing a one-piece swimsuit with dolls stuffed inside.

“Kill those f-cking babies,” one demonstrator screamed at the Supreme Court last week.

“I am pro-abortion. PRO. ABORTION. if I don’t want to be pregnant? vacuum that sh-t out of me like a dental assistant with my saliva,” one particularly crude Twitter user remarked.

How We Got Here

Mankind has been committing the sin of selfishness for millennia. Indeed, it was elevating his desires and conceit above the commands of God that separated man from his perfect communion with God in Eden. He has continued to practice selfishness and greed ever since.

It’s why civilizations have gone to war, overthrown governments, raped conquered provinces, abused the vulnerable, robbed, murdered, lied, and cheated. Selfishness is nothing new, and neither is abortion, which was practiced by the ancient Egyptians (and surely even earlier).

A Terminally Selfish Culture

Selfishness isn’t unique to our moment, but it does manifest today in a particularly straightforward way. If we believe the highest telos of our existence is self-discovery, our lives cease to serve any higher purpose than ourselves.

It makes sense, then, that our culture would glorify abortion because, by that paradigm, killing an inconvenient baby is a means to self-empowerment. If eugenicist abortionists pushed to kill off babies for the “good” of society a century ago, now they purport to do so for the “good” of the individual woman.

It’s why abortion activists can, in complete seriousness, advocate for the murder of a full-term child. It doesn’t matter to them that the baby is a living being — if he or she conflicts with a woman’s self-love, that baby doesn’t deserve to live. It’s perfectly consistent with our culture’s increasingly popular perception of having children as a fulfillment of their parents’ wants instead of a responsibility to cherish that requires sacrifice and self-denial.

That’s not to say people in previous times have been any less selfish; the fallen status of man is not measured in degrees. But the traits our culture chooses to elevate are linked to our celebration of abortion in especially obvious ways.

If self-gratification is our highest good, then any act (up to and including the murder of a child) becomes good if done in its pursuit. If we are our own arbiters of truth, then moral reality ceases to become an inhibition, and life itself ceases to become an inherent good. If limiting the licentious indulgence of our own desires is “oppression” and therefore the greatest sin, then the anti-abortion crowd becomes the bad guys.

Until we confront the self-idolatry of our culture, many people will truly believe abortion is not just a “necessary evil” but a self-empowering good. Merely convincing them that abortion takes the precious life of a baby does nothing to shatter that paradigm, if they value their own imagined “empowerment” more than that life. The message their mania requires is that something true, good, and infinitely worthy could exist that is greater than themselves.

https://thefederalist.com/2022/05/10/why-todays-left-is-willing-to-admit-abortion-kills-a-child-and-still-support-it/

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

861563  No.16247838

>>16247830

>>>16247825 (You)

>

>>laundering

>

>Yup, just ask expert finger painter, Hunter Biden

I actually like some of the things attributed to him. I don't really think he had any hand in them though

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

22dd31  No.16247839

>>16247833

good meme but….

*i

psakiiiiiiiiiii

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

345719  No.16247840

>>16247839

Yeah, I know. Not my meme.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

a82769  No.16247841

>>16247811

Your 5 monkeys experiment is very apropos.

Now extend it for 6000 years

Across all the generations

Why did the "scientists" agree to "punish" the monkeys?

Because they were brainwashed also?

Were they "afraid" of not complying with instructions?

When the old lady in the woods, stopped going to the church, and praying with the priest to "beg" god for relief from her arthritis pain, because she learned the old ways of using willow bark, they called her a witch and burned her at the stake. That's a pretty harsh way of ensuring the dogma "sticks" in a given society.

Look at who is under attack by the dogmatics today…and who isn't.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

eb8a34  No.16247842

>>16247838

Hmm. Never really looked. Candinski bullshit or like Escher or Bosch?

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

c8e3cd  No.16247843

File: e7ecea58902452c⋯.jpeg (636.32 KB, 1280x763, 1280:763, Remember_Roe_v_Wade.jpeg)

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

22dd31  No.16247844

File: fb2735d3185f91b⋯.png (106.17 KB, 1333x1022, 1333:1022, ClipboardImage.png)

>>16247836

can not build a wall

need illegals for votes & crime

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

241014  No.16247845

File: 6f588032291c9de⋯.jpeg (413.61 KB, 1241x1808, 1241:1808, D2E89ED9_C171_4043_88E5_2….jpeg)

Makes me wonder who Pompeo is lobbying for? Probably Israel

https://twitter.com/KevinRobertsTX/status/1522668874143043585?s=20&t=3OW2-yGgGQcu5s9B96KjMg

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

9f814e  No.16247846

File: ab332827d3fcbca⋯.png (174.64 KB, 438x429, 146:143, ClipboardImage.png)

https://www.thegatewaypundit.com/2022/05/target-launches-gender-affirming-products-including-chest-binders-packing-underwear/

We are living through strange times, frens.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

e24a5d  No.16247847

FAKE CHECKERS

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

79ca54  No.16247848

>>16247628

Yellow bricks? Gold? Follow the money.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

18150a  No.16247849

>>16247722

chkt

Their experts fucking suck!

Their disinformation specialists are A#1.

Lying in real-time.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

3e27ef  No.16247850

File: fe10fb0374feaf4⋯.png (115.61 KB, 224x255, 224:255, ClipboardImage.png)

File: fe10fb0374feaf4⋯.png (115.61 KB, 224x255, 224:255, ClipboardImage.png)

File: fe10fb0374feaf4⋯.png (115.61 KB, 224x255, 224:255, ClipboardImage.png)

File: fe10fb0374feaf4⋯.png (115.61 KB, 224x255, 224:255, ClipboardImage.png)

File: fe10fb0374feaf4⋯.png (115.61 KB, 224x255, 224:255, ClipboardImage.png)

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

57f56d  No.16247851

https://qresear.ch/?q=+OSS+

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

b0aad6  No.16247852

File: dfeacba2cf4a009⋯.png (860.72 KB, 848x662, 424:331, ClipboardImage.png)

>>16247838

Official Government Art Money Laundering

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

778aae  No.16247853

>>16247811

Second meme dialectic inversion to smear good people who do not disagree with such things being good, because they tend to unite the people while the 'antithesis' that meme divides and weakens people, which makes the meme posting either a mistake or intentional gaslighting, not even Anon's rules there,

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

a82769  No.16247854

>>16247845

Proxy war

Israel = Seat of a Religious Empire

China = Seat of a Commercial Empire

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

007b01  No.16247855

File: 7b54a6861d9dde9⋯.jpg (124.38 KB, 1284x910, 642:455, 1a_pepe.jpg)

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

f8b0de  No.16247856

File: de689bfe1bdd793⋯.gif (5.29 MB, 634x639, 634:639, de689bfe1bdd793502dfd41da0….gif)

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

3e27ef  No.16247857

File: 8a8fc635a650519⋯.png (129.67 KB, 227x255, 227:255, ClipboardImage.png)

File: 8a8fc635a650519⋯.png (129.67 KB, 227x255, 227:255, ClipboardImage.png)

File: 8a8fc635a650519⋯.png (129.67 KB, 227x255, 227:255, ClipboardImage.png)

File: 8a8fc635a650519⋯.png (129.67 KB, 227x255, 227:255, ClipboardImage.png)

File: 8a8fc635a650519⋯.png (129.67 KB, 227x255, 227:255, ClipboardImage.png)

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

d24bf4  No.16247858

File: 14c57090713cca9⋯.jpg (362.92 KB, 1374x1483, 1374:1483, biden_baphomet_baby_spirit….jpg)

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

f6284f  No.16247859

Something just occurred to me about abortion.

>Schools are gun free zones

>School shootings happen

>Rape is illegal

>Rape still happens

>Murder is illegal

>Murder still happens

Even if abortion becomes illegal it'll still happen.

I have a belief that pisses off the liberals and conservatives.

To my liberal friends. Abortions affect mostly non-white people so I'm glad there are less non-white babies.

To my conservative friends. What makes you think this country needs 500,000 more newborns are a year without a father? Do you honestly think this makes the country?

MUH PRINCIPLES!

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

3e27ef  No.16247860

File: be457103070595d⋯.png (80.1 KB, 170x255, 2:3, ClipboardImage.png)

File: 8a8fc635a650519⋯.png (129.67 KB, 227x255, 227:255, ClipboardImage.png)

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

1328bf  No.16247861

YouTube embed. Click thumbnail to play.

Can you even imagine what FREEDOM would feel like?

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

68840e  No.16247862

>>16247234

>Filtering

that bitch drink 3 gallon of city punch

PER DAY?!?!

okay

now her opinions/actions/demeanor makes COMPLETE sense

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

eb8a34  No.16247863

>>16247416

>Acknowledgement

Not an apology or retraction, however, this does have hints of AJ apologizing for pizzagate.

Anon knows that Ruby commited a bunch of crimes that night. She was just 'so proud' of her boss daughter that she couldn't keep her mouth shut about it.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

c8e3cd  No.16247864

>>16247859

life is sacred

you are worse than abortion

you outright choose who lives and dies

KYS

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

241014  No.16247865

>>16247854

True that, excellent simple explanation

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

e24a5d  No.16247867

>>16247859

so whats the plan to put the father back in the fam?

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

68840e  No.16247868

File: f8a25714e30c22d⋯.png (2.06 MB, 1500x1000, 3:2, Night_Shift_Bar_Tacorita.png)

>>16247236

>Taco Tuesdays

have a tacorita to wash it down

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

21eb2a  No.16247869

File: 63391bf32e1bacf⋯.png (319.62 KB, 1231x399, 1231:399, ClipboardImage.png)

https://www.msn.com/en-us/news/crime/u-s-arrests-third-suspect-in-assassination-of-haiti-president-moise/ar-AAX5Jp0?ocid

May 9 (UPI) – The United States on Monday charged a former Haitian senator with conspiring to kill Haitian President Jovenel Moise, becoming the third person charged by U.S. authorities in the assassination plot.

On Monday, U.S. prosecutors unsealed an indictment charging Joseph Joel John, 51, with being present during a meeting where an unnamed co-conspirator identified as a dual Haitian-American citizen secured the signature of a former Haitian judge to arrest and imprison Moise as well as providing them with immunity for thier actions.

John is also accused of obtaining vehicles and firearms to support the kidnapping operation, and faces a maximum sentence of life imprisonment if convicted.

Moise was killed July 7 of last year in a brazen attack on his home in the capital Port-au-Prince by armed assailants. His wife, Martine Moise, sustained gunshot wounds to her arms and thigh as well as suffered other injuries during the assault and was flown to Miami to receive treatment at Jackson Memorial Hospital.

Authorities have said 20 Colombian citizens and a handful of dual Haitian-American citizens participated in the plot to kidnap and arrest Moise that devolved into an assassination.

John was arrested in Jamaica along with three members of his family in mid-January at a St. Elizabeth home by members of the Counter Terrorism and Organized Crime Unit on immigration-related charges, the Jamaica Constabulary Force said in a statement that identifies him by the name Jean Joel Joseph.

He was then extradited to Miami on Friday after Jamaica in late April okayed the U.S. extradition request, federal prosecutors said.

John, who remains in U.S. law enforcement custody, made his first court appearance Monday afternoon before U.S. Magistrate Judge Lauren Louis.

His arrest follows that of Rodolphe Jaar in the Dominican Republic and of Mario Antonio Palacios in Jamaica. Both have been indicted on similar charges by U.S. prosecutors.

wtf

Joseph Joel John, 51

Jean Joel Joseph.

Jackson Memorial Hospital.

January

Jovenel Moise

July 7

Jamaica

Judge Lauren Louis

Rodolphe Jaar

whats his name?

U.S. prosecutors unsealed an indictment charging Joseph Joel John, 51

,the Jamaica Constabulary Force said in a statement that identifies him by the name Jean Joel Joseph.

haiti

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

83625a  No.16247870

Why aren’t Republicans doing anything about 2020 you ask?

THEY. WERE. IN. ON. IT.

#2000Mules

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

c8e3cd  No.16247871

>>16247868

bar keep

I'll have a cough of cuppy

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

70d622  No.16247872

File: 2401ca4d326c384⋯.jpeg (215.53 KB, 1440x1092, 120:91, 1530447989.jpeg)

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

ea584d  No.16247873

>>16247841

the underlying theme is control

the controlling class doesn't need to follow or believe in what they push so long as everyone else does because in doing so, it's not a threat to their said control.

>>16247853

baaaaaa

baaaaaaaaaaa

baaaaa

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

68840e  No.16247874

>>16247283

is that Oz with fucking Maria Abromovich?

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

c8e3cd  No.16247875

File: eab8bfc3c39c4c2⋯.jpg (148.48 KB, 924x500, 231:125, I_knew_Axis_Sally_and_you_….jpg)

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

345719  No.16247876

File: 640d0e4ddcfbcd8⋯.jpg (264.87 KB, 1792x1080, 224:135, Psaki_gaslight.jpg)

>>16247839

>>16247840

I was able to do a quick edit on it, and fixed it.

KEK

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

b0aad6  No.16247877

>>16247862

Answer this: why is water messed up in first place?

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

c8e3cd  No.16247878

>>16247872

40 years ago, maybe

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

e24a5d  No.16247879

>>16247874

why yes it is anon.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

a82769  No.16247880

>>16247865

If you align the players along those lines

You can see the sides, the motivations, and who's being used as a pawn.

Both sides are playing for money, so the bank wins either way.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

eb8a34  No.16247881

>>16247870

This actually seems right when Dinesh shows a group of [R]'s and they make jokes and purposely wrong connections. They were clearly trolling.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

c8e3cd  No.16247882

File: 823bd60db8a8a8e⋯.jpeg (801.34 KB, 1280x670, 128:67, and_you_still_don_t_trust….jpeg)

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

f6284f  No.16247883

>>16247864

>you outright choose who lives and dies

Not my fault niggers abort their kids more than whites.

>life is sacred

Yea yea. Do you have a problem with the death penalty?

>>16247867

That's a great question. We should ask our favorite conservative Ben Shapiro that.

>Mr. Shapiro since abortion is outlawed, what is your plan on making fathers stay with their kids?

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

1aa329  No.16247884

File: 95714fb2f074deb⋯.png (2.8 MB, 1138x1080, 569:540, 37A5C162_70C0_4220_998D_62….png)

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

68840e  No.16247885

>>16247351

>3. Saying “just breastfeed” to moms will not suddenly cause them to lactate

thats okay

anons on a mongolian basket weaving formum probably know more than her

just start breastfeeding

problem instantly solved

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

06e626  No.16247886

File: fa1fc4f36ab9b9b⋯.png (202.1 KB, 468x645, 156:215, Screen_Shot_05_10_22_at_11….PNG)

File: fa0b54d1141ef31⋯.mp4 (1.5 MB, 644x360, 161:90, kathybarnette1.mp4)

Kathy Barnette

@Kathy4Truth

The price of EVERYTHING is up!

Our ability to live is being squeezed.

JOE BIDEN DID THIS!

We need people in DC who understand what it’s like to live on a budget.

I’m running to fix this economic disaster!

Chip in $5 or more today to help me win: https://secure.winred.com/kathybarnette/gasvideo-pros

10:59 AM · May 10, 2022·Twitter Media Studio

https://twitter.com/Kathy4Truth/status/1524041421669421056

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

1328bf  No.16247887

File: 61cc8cf4b068ee2⋯.png (268.23 KB, 473x649, 43:59, Capture.PNG)

🎶 I would fly 9000 miles and I would fly 9000 more 🎶

The KC-46A Pegasus reached another milestone last week when airmen from

@22ARW

completed a 24.2-hour flight 🕰🤯

This marks the longest flight in

@AirMobilityCmd

history ✈️ 💯

https://twitter.com/22ARW/status/1523811727254724610

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

345719  No.16247888

>>16247870

They will all do this again in 2022, and 2024. Dems will take the senate, and gain seats in the house.

Screencap this, you saw it here first.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

241014  No.16247889

>>16247831

Hes the only world leader thats willing to lay the truth of leaders and what they plan and gain is (also Trump)

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

45a03a  No.16247890

>>16247789

And yet

here you are

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

c8e3cd  No.16247891

>>16247883

you aint ded yet

racists self abort immediately

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

b0aad6  No.16247892

File: 3636ba72aca43b7⋯.jpg (12.37 KB, 289x193, 289:193, 290x0.jpg)

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

3f4f6a  No.16247893

>>16247882

>and you still don't trust me?

lol no

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

80323f  No.16247894

File: 9f3a2b6888c697a⋯.jpg (356.29 KB, 1582x2048, 791:1024, FRw55LzWQAId1rO_jpeg.jpg)

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

22dd31  No.16247895

File: 5077b22d54d1ec2⋯.png (777.42 KB, 1333x803, 1333:803, ClipboardImage.png)

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

e5b9ed  No.16247896

>>16247753

Take their Federal Banking Charter away. They are not part of the government.

Where's the gold ? Not in Fort Knox or Manhattan anymore. Just show amounts for optics. Probably not even gold, Painted Lead.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

c8e3cd  No.16247897

>>16247884

everyone and anyone is a joo

so you lost

we all converted

shalom

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

70d622  No.16247898

File: 825abbf263b79d3⋯.gif (5.47 MB, 640x360, 16:9, 7989db516c0a5d97e7360c61c2….gif)

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

3f4f6a  No.16247899

>Sauce?

34 posts

asks for sauce about R's being in on it

kys

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

5f214a  No.16247900

Twitter embed. Click thumbnail to play.

>>16247881

NRSC complicit

https://twitter.com/TalkMullins/status/1523733546921185280

Still waiting for the

@NRSC

to respond…

Quote Tweet

Real America's Voice (RAV)

@RealAmVoice

· 20h

"It's indisputable evidence that there was organized crime in the 2020 election, that took place at the dropboxes."

#RAV Correspondent @TalkMullins joins @RealMirandaKhan to give a sneak peek at @DineshDSouza's new documentary, #2000Mules.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

eb8a34  No.16247901

>>16247867

One-father houses with many kids and multiple wives.

This way, the real men that can actually be a great example to many of his children instead of just having a handful that may die before his legacy can live on.

One man, one woman is a taxation ploy. What other biblical laws are so harshly enforced like polygamy?

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

b0aad6  No.16247902

>>16247887

Flying is fun. Safer than Driving.

Unfortunately TSA fucked it up.

Then DHS fucked it up.

Then WHO fucked it up

then CDC fucked it up.

Then UN fucked it up

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

80323f  No.16247903

>>16247789

You take the "shot" when the single round does max blast

Not before

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

68840e  No.16247904

>>16247468

>EU Commission is expected to publish the draft law on "chat control" tomorrow. Lawmakers seekAI-based checksof all message content & imagesdirectly on users' devices.

so

much

winning

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

718969  No.16247905

QBQ? No answer? No response? Oh ok.

(Q Board Question)

Do you think staff has honesty in mind anymore?

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

eb5ee7  No.16247906

File: bb489651a452043⋯.jpeg (444.87 KB, 828x766, 414:383, 91266049_ABCD_4F1F_A7A7_C….jpeg)

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

bf3959  No.16247907

File: 9f465f78bfc5943⋯.png (26.13 KB, 812x335, 812:335, ClipboardImage.png)

The board seems to run fine until fuckstick here starts doing this with twitter embeds that don't work here.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

aab6da  No.16247908

>>16247905

They've done nothing but lie since they took over, so no.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

5fef26  No.16247909

File: 822a7e586141d12⋯.jpg (84.27 KB, 635x395, 127:79, asdno.jpg)

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

1328bf  No.16247910

File: 5197407797d7491⋯.png (374.39 KB, 527x557, 527:557, Capture.PNG)

File: 78362c016870ba2⋯.png (5.24 KB, 409x94, 409:94, image_2022_05_10_112735563.png)

U.S. Marines along with the UH-1Y Venom and AH-1Z Viper aircraft platform with Marine Light Attack Helicopter Training Squadron (HMLAT) 303, Marine Aircraft Group 39,

@3rdmaw

conduct a mass flight at

@MCIWPendletonCA

. (

@USMC

photo by Lance Cpl. Daniel Childs)

https://twitter.com/1stMEF/status/1524037794913415169

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

c8e3cd  No.16247911

>>16247893

people can change, no?

I used to take all my vaccinations

USED TO

am I still a slave to vaccines, or did I change?

now, what about Oz. You won't give him the opportunity to be right for once?

WTF is wrong with you?

oh, just a hater

carry on

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

45a03a  No.16247912

File: 734d8a4e99890c0⋯.png (186.71 KB, 643x408, 643:408, scavinoMiaPhi_2126.png)

>>16240087 pb

>how did you get 4151?

2 year delta

Philadelphia 76ers

IPOT1776

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

e5b9ed  No.16247913

>>16247870

The UNIPARTY is REAL !!!

Throw them all out ?? But whom can we trust ?? AUDIT everyone existing POLs first. If there is an offshore account, Shell corporation anywhere in the family for 3 generations, they are out.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

9aafcb  No.16247915

File: cd823c904928ff9⋯.png (57.94 KB, 303x166, 303:166, ClipboardImage.png)

File: 9ecead38cb60657⋯.png (449.95 KB, 640x422, 320:211, ClipboardImage.png)

File: 685be7b6b2c05b7⋯.png (2.73 MB, 1229x972, 1229:972, ClipboardImage.png)

Exoteric politics has little relation the the reality of social control systems.

Every system needs periodic flushing of soured content – historical contradictions and discrepancies become evident because the lies told in one era become apparent in the light of that which is coming.

Puppets shall be wailing, and gnashing teeth and flapping in judicial robs like agitated ducks, 'conferencing' in cloakrooms, having fearful nosebleeds, fixing blame on others, one minute screaming for executions, the next fearing for their own lives demanding constitutional protections.

All fear the stumbling faceless slaves, their faces ground off in the enormous Asian ergastulas where millions of imprisoned minions sicken making cellular devices.

Biological slaves are rapidly being replaced by technology they built, computationally reconfigurable robots.

What do you suppose happens to faceless slaves superfluous to the cult's needs?

https://www.extremetech.com/extreme/306909-report-china-sells-minorities-into-forced-labor-to-benefit-apple-foxconn-others

https://www.extremetech.com/computing/318167-report-apple-ignored-its-partners-repeated-violations-of-chinese-labor-laws

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

778aae  No.16247916

File: 5134e10a454d15b⋯.png (115.32 KB, 679x1164, 7:12, ClipboardImage.png)

File: a18fadc06c725c2⋯.png (1.03 MB, 1451x1200, 1451:1200, ClipboardImage.png)

File: 713b1f27f5223d5⋯.png (32.12 KB, 655x544, 655:544, c43ceac033c16c28.png)

==Pharma corruption dismantling in plain sight. FDA 'in code' just admitted that the covid numbers were boosted by 'borrowing' from the flu cases.

Biggest criminal psyop ever is being uncovered before our very eyes.

BOOM

Future is proving past

https://m.theepochtimes.com/fda-americans-should-treat-covid-19-like-the-flu_4453370.html

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

80323f  No.16247917

YouTube embed. Click thumbnail to play.
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

e24a5d  No.16247918

>>16247907

click the embed to make work

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

173df4  No.16247919

notable opine

>>16247913 AUDIT everyone existing POLs first. If there is an offshore account, Shell corporation anywhere in the family for 3 generations, they are out.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

68840e  No.16247920

File: 78ff3c1a89e80ea⋯.png (1.47 MB, 1270x1885, 254:377, Nespresso_Cocaine.png)

>>16247514

>Are they getting rid of evidence when they get rid of baby formula?

>Nestle is a very powerful company. Anon knows people who work in their R&D.

story related?

Over 500 kg of cocaine found in coffee delivery for Nespresso

May 5, 2022

10:35 AM PDT

>https://www.reuters.com/business/over-500-kg-cocaine-found-coffee-delivery-nespresso-2022-05-05/

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

18150a  No.16247921

File: e35fdbf42c2d3bb⋯.jpg (27.81 KB, 235x255, 47:51, b3aa2fed97008a4d6a7c1fae99….jpg)

>>16247823

>>16247823

Crazy Ruskie.

He'll probably offer food to starving people if the people take out their corrupt leaders.

Die starving on your knees, or standing taking down evil.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

e5b9ed  No.16247922

>>16247882

Oz needs to renounce his Turkish citizenship and call for all members of congress and any candidate to have citizenship and allegiance to the Republic ONLY !!!

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

c8e3cd  No.16247923

>>16247919

this is what I have been saying about the red wave

what flavor of R's will we get?

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

1328bf  No.16247924

>>16247917

Ear worm of the day.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

85bc47  No.16247925

>>16247888

trips cheked

and nothing will happen

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

80323f  No.16247926

>>16247896

Tungsten plated with gold

Can't remember if it was China or Canada that was having a go at that

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

e0487e  No.16247927

File: f99d9698c590be9⋯.png (219.48 KB, 516x521, 516:521, ClipboardImage.png)

File: 7716bccf534e7da⋯.png (18.88 KB, 517x281, 517:281, ClipboardImage.png)

File: c095a5a97095965⋯.jpg (19.84 KB, 612x413, 612:413, Pepe_Karate_Sunset.jpg)

>>16247870

It's kind of the point of this exercise, isn't it? To show everyone the truth?

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

241014  No.16247928

>>16247775

Thats not extreme its normal

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

a3014c  No.16247929

File: 2efaa500c0bdcee⋯.png (2.99 MB, 2000x1317, 2000:1317, GermanyEgypt.png)

File: 8a0201b95953cf5⋯.png (9.22 MB, 3548x2574, 1774:1287, inbreds.png)

File: 398d1b13f24c277⋯.jpg (37.6 KB, 1024x768, 4:3, Waffen_SS.jpg)

File: 1a0b57fb8df61ec⋯.png (349.56 KB, 995x659, 995:659, zhekel.PNG)

File: d08bf24a634f776⋯.png (892.4 KB, 1296x1290, 216:215, jakobodog.PNG)

Jesus the creator of humans was on earth to tell humans that those that (((inbreed))) have to be killed because they no longer have Jesus God as their creator because (((inbreeds))) from (((inbreeding))) have instead an (((infinite inbreeding demon of incestuous child rape))) as the 'creator' of the (((dog shit))) that is (((inbred))) jews and the reason why Jesus ordered drowning for child rapists is because (((inbreeding))) = child rape and (((inbred))) jews will only continue to rape and eat children as seen with (((maxwells and epsteins))) because (((inbreeding))) = ((('too inbred to care'))) (((inbreds))) unless child rapists are drowned first as ordered by Jesus.

it is impossible to 'outbreed' ((('too inbred to care'))) as all (((inbreds))) have only the (((infinite inbreeding demon of incestuous child rape))) where humans instead naturally only have Jesus God as their creator trying to save humans from the endless hell of ((('too inbred to care'))) where all (((inbreds))) reside.

drown all ((dogs))) as (((dogs))) are of the same (((incestuous child rape inbreeding demon))) as jews are from (((inbreeding))) and (((dogs))) are trying to 'have' the (((dog))) 'owners' 'mentally inbred' enough to pick up (((dog shit))) until the (((dog))) is dead while infants get their genitals mutilated

Never have a (((dog))) around children as all (((inbreds))) are pedophiles and can only try to make others ((('too inbred to care'))) pedophiles unless drowned first.

sex is only for adult man and woman in a marriage to start a family!

protect your children from (((degeneracy))) or your children will eventually kill themselves.

Ban genital mutilation of infants!

never promote bad behaviour

only time to think

The 10 states with the highest rates of genital mutilation of infants compared to countries with same rate

West Virginia (87.00%) Equatorial Guinea (87.00%) Oman (87.70%)

Michigan (86.00%) Mali (86.00%) Kuwait (86.40%)

Kentucky (85.00%)

Nebraska (84.00%)

Ohio (84.00%) Guinea (84.20%)

Indiana (83.00%)

Iowa (82.00%)

Wisconsin (82.00%)

South Carolina (81.00%) Bahrain (81.20%)

Pennsylvania (79.00%) French Polynesia(78.00%)

https://worldpopulationreview .com/state-rankings/circumcision-rates-by-state

never promote bad behaviour

only time to think

Ban genital mutilation of infants!

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

007b01  No.16247930

File: a1cf87a0496f382⋯.gif (2.51 MB, 320x320, 1:1, bike.gif)

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

5f214a  No.16247931

>>16247907

>n fine until fuckstick here starts doing this with twitter embeds that don't work

The embeds work if you click on them.

Jim told us months ago when the image server was down, what embeds work.

Twitter was one of them.

Besides. the link has a video that also plays.

Maybe you should check your equipment Fuckstick

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

c8e3cd  No.16247932

>>16247922

is dual citizenship legal, or are you raising the bar for no fucking legal reason?

change the law faggot

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

e24a5d  No.16247933

>>16247910 U.S. Marines along with the UH-1Y Venom and AH-1Z Viper aircraft platform with Marine Light Attack Helicopter

>Light Attack

CMON MAN THATS 3 USMC CONFIRMS FOR THE FLASH

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

18150a  No.16247934

File: bd89fbb8068f990⋯.jpg (11.89 KB, 255x143, 255:143, 317df6a1884803cd7dcb47a876….jpg)

>>16247834

rgr dat

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

e8e24c  No.16247935

File: e17c9142ae8384d⋯.png (811.55 KB, 757x727, 757:727, bidan.png)

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

074bea  No.16247936

File: 468471e674da959⋯.jpg (119.77 KB, 1080x1064, 135:133, FSZ5NcmX0AUBPK_.jpg)

>>16247823

2 moar weeks

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

cd3460  No.16247937

>>16247823

fwiw,

4:20 on his watch.? Appears both hands on 4.

Oddly, I'm more certain of seconds hand movement than the two primary.

Seconds hand goes from 15-25 (during 1-10s portion of video).

Cut. Rewind watch.

Seconds hand starts at 15 again, goes from 15-40 (during 10-35s portion of video).

Transitions to black/TikTok logo between 35-36s portion of video.

All hands on 4 at both 5 and 15 secs of video.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

1328bf  No.16247938

File: c06698852728e5f⋯.jpg (25.32 KB, 255x213, 85:71, bc627847c7f87fdddb6c37db61….jpg)

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

e24a5d  No.16247939

>>16247179

#20552

>>16247187 Ukraine Ops Report

>>16247233 New documentary PANDAMNED

>>16247235, >>16247305, >>16247327, >>16247773 @DineshDSouza Chief Justice Roberts in a 2018 opinion: “When the Government tracks the location of a cell phone, it achieves near perfect surveillance

>>16247239 Partial DS List

>>16247258, >>16247312 Scholars Question Mehmet Oz’s Justification for Maintaining Turkish Citizenship

>>16247263, >>16247273 Meme OPERATION: Save Your Rights (#Nebraska && W VA)

>>16247275 DAILY CHECKOFF ROUTINE

>>16247282 Democrats’ Bill to Codify ‘Roe’ and Abortion Omits the Word ‘Woman’

>>16247298 Fauci Rails Against the ‘Normalization of Untruths’ in Commencement Speech

>>16247314, >>16247813 Lori Lightfoot Call to Arms (Inciting Violence?)

>>16247323 Fort Lee Drill Sergeant Fired After Arrest in Underage Prostitution Sting Operation

>>16247332 PAT44 USAF G5 departed JBA ne

>>16247336 Pennsylvania Senate Poll: Dr. Oz Narrowly Leads Three-Way Race

>>16247359 5 Radical Facts About Incoming White House Press Secretary Karine

>>16247361, >>16247385 Durham/Sussman in the news

>>16247377 HUNTER BIDEN OIL RIG???

>>16247402 BLM Co-Founder Admits She Used Group’s $6 Million Property to Host Personal Parties

>>16247417 Lori Lightfoot: $500,000 in Funding for Abortions for Non-Chicagoans Is ‘a Down Payment

>>16247429 NATO state labels Russia ‘supporter of terrorism’

>>16247437 Europe-Med activity Starting over Israel

>>16247454 Civilians killed in Donetsk shelling?

>>16247482, >>16247486, >>16247490 The Swamp Today

>>16247506 PDJT: Nebraska && W Virginia , #Govote today for Charles W. Herbster and Alex Mooney

>>16247531 PF housekeeping The Italian AF AC (IAM3121 Falcon 900) that landed yesterday was not Super Mario Draghi

>>16247631 Kristi Noem called out on attacking S Dakota conservatives

>>16247653, >>16247782 Anon Opines - Have we reached the Precipice?

>>16247628, >>16247643, >>16247662, >>16247671 Weird Yellow Brick Road Found in Pacific Ocean (OZ Comms?)

>>16247680 @FORSCOM During Operation Lethal Eagle II @101CAB worked closely with @TheRakkasans

>>16247696 Anon has a Question - Are the 40+ Jewish dual passport holders in Congress (foreign agents) a problem?

>>16247703 DonaldJTrumpJr - You can't find baby formula (Baby Formula Vs Ukraine Support, who got the funding?)

>>16247706 Hawley on the heels of Disney (Copyright Protection)

>>16247711 @OfficialFtSill Dreams don’t work unless you do.

>>16247762 Hundreds Arrested In Massive Child Porn Investigation, Exposing International Network Of Abuse

>>16247775 Missouri Senate passes extensive election integrity bill.

>>16247787 Nonprofit Watchdog Uncovers $350 Million in Secret Payments to Fauci, Collins, Others at NIH

>>16247797 Help keep voter rolls Accurate. https://www.iv3.us/

>>16247837 Today’s Left Is Willing To Admit Abortion Kills A Child And Still Support It

>>16247887 The KC-46A Pegasus reached another milestone last week - 24.2-hour flight

>>16247910 U.S. Marines along with the UH-1Y Venom and AH-1Z Viper aircraft platform wit

>>16247910, >>16247933 U.S. Marines along with the UH-1Y Venom and AH-1Z Viper aircraft platform with Marine Light Attack Helicopter (FLASH)

>>16247916 FDA 'in code' just admitted that the covid numbers were boosted by 'borrowing' from the flu cases?

>>16247913 OPINE - AUDIT everyone existing POLs first. If there is an offshore account, Shell corporation anywhere in the family for 3 generations, they are out.

BAKING

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

eb8a34  No.16247940

>>16247906

Kek. The insanity of the fourth album is the culmination of all before it.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

85bc47  No.16247941

>>16247890

it's fun triggering the sheep

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

c8e3cd  No.16247942

404 sucks with coffee

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

5970d8  No.16247943

>>16247922

Whoever held dual citizenships should never be allowed to run for any position in government, education or finance.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

241014  No.16247944

>>16247725

They are awakening, our influence is WW, God’s got this

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

68840e  No.16247945

>>16247653

>prove me wrong

its actually quite difficult to "prove" a negative

one can prove that something DID happen

one can prove that a state DOES exists

prooving the opposite is paradoxically much more difficult

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

eb8a34  No.16247946

File: 45a5d2ff6f03fbb⋯.jpeg (518.18 KB, 1440x1332, 40:37, TheNewsLizzy.jpeg)

>>16247906

>>16247940

Kek. Gotta be patient with the picrels.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

173df4  No.16247947

>>16247910, >>16247933 U.S. Marines along with the UH-1Y Venom and AH-1Z Viper aircraft platform with Marine Light Attack Helicopter (FLASH)

c'mon baker, the flash thing ?

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

e5b9ed  No.16247949

>>16247932

You cannot serve two masters!!!

As an elected official of the republic you should be only of the republic. As soon as we get faggots like you out of congress we will change the law.

Pick a country !! Why would you have dual citizenship ? Because you are not truly an American.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

a599ef  No.16247950

File: 27b802fe931465f⋯.jpg (94.2 KB, 1125x1125, 1:1, Eat_the_Rich_GQ_2019_11041….jpg)

File: 0f9bc31a412354c⋯.jpg (45.43 KB, 900x500, 9:5, CnvlobrXEAAl_aF.jpg)

File: 1c0a9adf47fb568⋯.jpg (54.07 KB, 414x551, 414:551, jakevkmozezvexml1ksdyh804c….jpg)

File: 913c1388ab3397a⋯.jpg (145.16 KB, 1200x628, 300:157, How_to_Think_Like_a_Millio….jpg)

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

8800a9  No.16247951

YouTube embed. Click thumbnail to play.

>>16247927

>Stategic.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

e0487e  No.16247952

File: 180426b059d53b5⋯.png (2.38 MB, 1400x1400, 1:1, ClipboardImage.png)

>>16247916

So when is Devin going to get a nosering and grow out a goatee?

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

c8e3cd  No.16247953

>>16247941

to think you've "triggered" someone says a

lot about your personality disorder

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

80323f  No.16247954

>>16247924

A catchy tune from days past

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

79ca54  No.16247955

File: 5c36c8d45150de3⋯.gif (1.98 MB, 498x466, 249:233, billy_madison_lipstick.gif)

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

345719  No.16247958

File: e471b7e29d547e5⋯.png (735.5 KB, 500x809, 500:809, ClipboardImage.png)

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

f6284f  No.16247959

>>16247891

Typical "DIGITAL SOLDIER" can't debate the merits so results to insults.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

8800a9  No.16247960

r>>16247951

>Stategic.

:Strategic.*

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

bf3959  No.16247962

File: de17560504f0bb3⋯.png (144.52 KB, 160x596, 40:149, ClipboardImage.png)

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

85bc47  No.16247963

>>16247922

the "greatest ally" will not like this

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

fae159  No.16247964

File: aaf3bc2ab56bcba⋯.png (349.71 KB, 1007x657, 1007:657, supermanmovie.png)

File: 674168707301a34⋯.jpg (114.67 KB, 2560x1371, 2560:1371, photo_2022_05_08_14_52_55.jpg)

File: a8517137a622025⋯.jpg (65.53 KB, 534x667, 534:667, anubisstatuemet.jpg)

File: 21b7bdf3f08715c⋯.jpg (815.44 KB, 2487x3557, 2487:3557, studiesineastchr12free_004….jpg)

File: 26762fe3fc693a7⋯.jpg (296.38 KB, 1244x1779, 1244:1779, studiesineastchr12free_003….jpg)

anubis is the 'anti-christ' the 'khrist of the inbred' or 'the least inbred' of the (((inbreds))), a jackal ~ (((jakob))) and can only learn that as it is a product of (((inbreeding))) it should never exist as how the (((inbred))) judas was made to hang by Jesus God.

(((inbreeding))) = child rape = endless death = godless creature to be drowned.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

e5b9ed  No.16247965

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

85bc47  No.16247967

>>16247953

lofl, well i am biploar and slighlty schizo so there's that

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

f6284f  No.16247968

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

c8e3cd  No.16247969

>>16247943

dual citizenship is legal

what have you done about it except bitch about something legal?

everyone is a joo

you lost

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

e24a5d  No.16247970

>>16247179

FRESH PRIMARIES

Q Research General #20553: #GoVote today for Charles W. Herbster and Alex Mooney

>>16247948

>>16247948

>>16247948

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

85bc47  No.16247971

>>16247968

lmao, your name is giving me massive kekking

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

c8e3cd  No.16247972

>>16247949

it's legal anal wart

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

68840e  No.16247973

File: bd8a268c49a969d⋯.jpg (193.04 KB, 1000x942, 500:471, 9dd2a21dceee50814236ad7b3b….jpg)

>>16247711

Fort Sill is comming on hot with the COMMS recently

image is top kek

heres lookin at (You) milanons

teamwork makes the dream work fags

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

385082  No.16247974

>>16247967

>biploar and slighlty schizo

arent we all

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

173df4  No.16247975

>>16247969

enforce OG 13th amendment

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

e83c83  No.16247976

File: 62fa5492c85bf0d⋯.jpg (21.75 KB, 288x450, 16:25, mariabartiormo.jpg)

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

007b01  No.16247977

File: 34563037a597c6f⋯.jpg (46.02 KB, 680x436, 170:109, Army_sky.jpg)

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

8800a9  No.16247978

File: 9578ee58ce8882e⋯.jpg (11.23 KB, 255x205, 51:41, 9578ee58ce8882e7214dc17619….jpg)

moar

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

c8e3cd  No.16247979

>>16247959

you need to die forthwith

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

f6284f  No.16247980

YouTube embed. Click thumbnail to play.

>>16247971

Thanks. I got it from this.

Rabbi Haim Goldenstein Shekkelblat gives a donation

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

5f214a  No.16247981

File: e145609759fc83a⋯.png (163.84 KB, 654x615, 218:205, ClipboardImage.png)

>>16247907

Works -> see.

Also - you must have also OVERLOOKED the actual twitter link in the post too.

Don't trip over yourself looking,

again https://twitter.com/RealAmVoice/status/1523731102661169152

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

007b01  No.16247982

File: bfd9eb68dc6c5bc⋯.png (583.37 KB, 1175x875, 47:35, Missing_13th_Amendment_NO_….png)

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

68840e  No.16247983

>>16247745

>nothing but spam

and yet

BV's dont delete it…?

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

e24a5d  No.16247985

>>16247947

LEARN THEIR COMMS

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

5970d8  No.16247986

>>16247969

Can a player on a team wear an opponents jersey during a game?

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

007b01  No.16247987

File: b058999c1a6da8c⋯.jpg (79.85 KB, 843x798, 281:266, Getting_Band.Jpg)

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

c8e3cd  No.16247988

>>16247967

and stupid, you forgot that

change the law and stop bitchin

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

e24a5d  No.16247990

>>16247179

FRESH PRIMARIES

Q Research General #20553: #GoVote today for Charles W. Herbster and Alex Mooney

>>16247948

>>16247948

>>16247948

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

f6284f  No.16247991

>>16247979

Stupid goy.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

c8e3cd  No.16247993

>>16247986

its legal cunt bubble

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

78eed0  No.16247994

>QR is ded

>How ded is it?

Oh so close to having a 4 hour long Day Shift bread.

Will have to settle for 3.5 instead.

Better luck hitting 4 in the next bread.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

06e626  No.16247996

>>16247311

>She's rocketing in the polls because she's real and authentic, Oz is just playing lip service to MAGA and it shows

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

e5b9ed  No.16247997

>>16247883

Why do you think they are pushing drugs to delay puberty ?

Eunuchs can't make babies.

Trying to trigger emotion is a leftist tactic.

But NAZIs were always on the left, National Socialists are still Socialists.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

718969  No.16247998

>>16247983

>Every spam is OSS, disregard other spam

>Signs post modernist definition of spam is simulacra in simula.

>spam is now content just don't be OSS simultaneously

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.



[Return][Go to top][Catalog][Nerve Center][Random][Post a Reply]
[]
[ / / / / / / / / / / / / / ] [ dir / random / islam / jewess / komica / lit / loomis / pen / wactor / x ]