[ / / / / / / / / / / / / / ] [ dir / cow / cyoa / k / kind / mu / s / shousa / tech ]

/newsplus/ - News +

Read the News!
Email
Comment *
File
Password (Randomized for file and post deletion; you may also set your own.)
Archive
* = required field[▶ Show post options & limits]
Confused? See the FAQ.
Embed
(replaces files and can be used instead)
Voice recorder Show voice recorder

(the Stop button will be clickable 5 seconds after you press Record)
Options

Allowed file types:jpg, jpeg, gif, png, webm, mp4
Max filesize is 16 MB.
Max image dimensions are 15000 x 15000.
You may upload 5 per post.


THE RULES
The heartbeat of 8kun is strong


File: 1b79f821083fb67⋯.jpg (128.79 KB, 853x480, 853:480, coronavirus_dr_luc_montagn….jpg)

7a7cac  No.257655[Last 50 Posts]

In a highly significant development, Professor Luc Montagnier, the French scientist who shared the 2008 Nobel Prize in Medicine for discovery of the human immunodeficiency virus (HIV), has added his voice to those who believe the new coronavirus was created in a laboratory. Interviewed on the CNews channel in France, Montagnier asserted that the virus had been designed by molecular biologists. Stating that it contains genetic elements of HIV, he insisted its characteristics could not have arisen naturally.

Asked by the CNews interviewer what the goal of these molecular biologists was, Montagnier said it wasn’t clear. “My job,” he said, “is to expose the facts.” While stressing that he didn’t know who had done it, or why, Montagnier suggested that possibly the goal had been to make an AIDS vaccine. Labeling the virus as “a professional job…a very meticulous job,” he described its genome as being a “clockwork of sequences.”

“There’s a part which is obviously the classic virus, and there’s another mainly coming from the bat, but that part has added sequences, particularly from HIV – the AIDS virus,” he said.

Growing evidence that the virus was ‘designed’

Montagnier also pointed out that he wasn’t the first scientist to assert that the coronavirus was created in a laboratory. Previously, on 31 January 2020, a research group from India had published a paper suggesting that aspects of the virus bore an “uncanny similarity” to HIV. Taken together, the researchers said their findings suggested the virus had an “unconventional evolution” and that further investigation was warranted. While the researchers subsequently retracted their paper, Montagnier said they had been “forced” to do so.

https://www.dr-rath-foundation.org/2020/04/nobel-prize-winning-scientist-who-discovered-hiv-says-coronavirus-was-created-in-laboratory/

____________________________
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

f0da6a  No.257656

File: 7cb299d3c36a78e⋯.jpg (43.52 KB, 300x482, 150:241, 0_Gq0vv2E9VnX7FkmM.jpg)

>>257655

OP is a stupid fucking nigger

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

f0da6a  No.257657

>>257655

>Dr. Rath Foundation . Org

complete trash

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

f0da6a  No.257658

>>257655

poor old burdock. you don't even know what the RAT13 Coronavirus is, you don't know the difference between a BSL-2 Lab & a BSL-4 Lab is, you have absolutely no clue what GAIN OF FUNCTION is, you have no idea what the PREDICT Program is, you have no idea how many PREDICT Labs there are, do you know what ANIMAL-PASSAGE is. To be succinct, you don't know jack fucking shit.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

f0da6a  No.257659

File: 759362b0b29a422⋯.jpg (377.3 KB, 1227x1280, 1227:1280, 20200429_091833.jpg)

12 years ago, Dr. Matthias Rath was completely discredited in his industry by his colleagues & by journalists, who he tried to sue, but ended up dropping his lawsuit once he realized he couldn't win in court, and his reputation had already been destroyed.

He's a nutjob and a charlatan.

https://www.theguardian.com/world/2008/sep/12/matthiasrath.aids2

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

c09570  No.257662

>>257655

© craigslist - Map data © OpenStreetMap

(google map)

when someone honestly point somebody could very well connect a SSEEXXy female here, you to be dead inappropriate partner think of all by yourself warned, all which is considered to be remaining here are often the pigs attempting to get gentlemen searching pertaining to SSEEXX, and then scammers appearing while girls, requiring one get verified. at this moment a little really good ideas. i could vouch for the sight which usually actually has genuine each day ladies the merely require to help bang. this particular website name called BANG/PALS. Put that name in to your web browser, and / or run a searching with regard to BANG,PALS when ever you are serious about obtaining laid, it is your current very best bet! This is one involving those things someone should notice to believe so proceed take a look.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

c09570  No.257663

>>257655

I offer my self as your prisoner or indentured servant for 72 hrs must have work for me to do yard or hard work in general ill pay my own way must be picked up handcuffed for ride there and keep leg ironed (shackled) will provide handcuffs and restraints ill sleep outside chain to tree

Yours Truly,

Philip Fairbanks

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

45f1e2  No.257664

>>257656

What a compelling argument. You really explained your point.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

45f1e2  No.257665

>>257655

>Professor Luc Montagnier

>>257659

>Dr. Matthias Rath

What does Matthias have to do with Luc?

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

c09570  No.257666

>>257655

Looking for a man to talk to, become friends with, see where it goes. I have just recently lost my fiance' of 4 years. The heart is broken but I know I must move on.

I am 59, 5'1", white, bbw. I use oxygen and a jazzy chair to help me with getting around due to a lung issue. Never smoked, it just happened.

I love going out, to the beach, most anywhere. Love music having fun, camping out, wherever life takes me. I dont slow down. Alot of life to live and love to give…..

Are you the one….

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

45f1e2  No.257667

>>257665

>>257659

I see - it's his foundation. I put a nobel prize winner in a higher place than a org he works for if the org is said to be fucked.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

55198e  No.257668

>>257665

Dr. Matthias Rath: OP copied and pasted this article from Rath's bullshit website

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

55198e  No.257669

>>257667

feel free to explain the nuts & bolts of the 'clockwork of sequences' of the genome that indicate it has genetic elements of AIDS. when you're finished describing the technical markers, please explain what Gain Of Function means.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

55198e  No.257670

>>257667

by the way, ALL genetics sequencing is a 'clockwork of sequences'. there is nothing in the sequencing that indicates the virus wasn't a product of natural selection, and in fact, if there were, it would jump out at researchers like a smokestack installed into a Ford Pinto. The virus was clearly a product of animal passage, most likely part of the Wuhan Institute of Virology's Gain Of Function research.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

55198e  No.257671

>>257667

Luc Montagnier's claims have been laughed at by his colleagues who have also examined the gene sequencing.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

55198e  No.257672

File: d500433c6bc749d⋯.jpg (1.16 MB, 1400x2159, 1400:2159, 0_UDfHbiP9fXZgiW_i.jpg)

The Wuhan Institute of Virology is one of many labs to receive PREDICT funding. Shi Zheng-Li, a virologist known as "bat woman" for her group's work in collecting hundreds of coronaviruses, and her staff at the Institute explored the same bat caves that were thought to have given rise to the original SARS virus in 2002. Her scientists penetrated remote caves, swabbing bats' anuses and collecting their excretions. When they returned to the lab, they cultured the viruses they found, determined their genomic sequences and tried to determine how they infect cells and animals in the lab.

The Institute began a program of gain-of-function research into bat coronaviruses in 2015. That involved taking selected strains and seeking to increase the ability of those viruses to transmit from one person to another. The gain-of-function research went hand-in-hand with the surveillance project. As scientists identified new classes of bat viruses that have the ability to infect human cells, that raised the question of what changes would have to arise in nature to make that virus transmissible in humans, which would pose a pandemic threat.

In 2015, the Wuhan lab performed a gain of function experiment using cut-and-paste genetic engineering, in which scientists take a natural virus and directly make substitutions in its RNA coding to make it more transmissible. They took a piece of the original SARS virus and inserted a snippet from a SARS-like bat coronavirus, resulting in a virus that is capable of infecting human cells. A natural virus altered with these methods would be easily flagged in a genetic analysis, like a contemporary addition to an old Victorian house.

A virus produced with animal passage methods would be much harder to spot. These viruses are not directly manipulated. When the virus passes from one animal to the next, it undergoes something similar to what would happen in the wild during the course of its evolution. A wild coronavirus passed through 10 ferrets would be difficult to identify as having been engineered or manipulated.

OP is a nigger

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

a370cf  No.257673

>>257667

>Nobel Prize Winner

you misspelled Noble

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

4ef820  No.257674

The proponents of gain-of-function research were just as passionate. "We need GOF experiments," wrote Fouchier in Nature, "to demonstrate causal relationships between genes or mutations and particular biological traits of pathogens. GOF approaches are absolutely essential in infectious disease research."

The NIH eventually came down on the side of Fouchier and the other proponents. It considered gain-of-function research worth the risk it entailed because it enables scientists to prepare anti-viral medications that could be useful if and when a pandemic occurred.

By the time NIH lifted the moratorium, in 2017, it had granted dozens of exceptions. The PREDICT program, started in 2009, spent $200 million over 10 years, sending virologists all over the world to look for novel viruses and perform gain-of-function research on them. The program's funding ran out in 2018 and it wasn't renewed. Early this year, after the Trump administration drew criticism for canceling the program, it granted a six-month extension.

By the time the current pandemic hit, animal-passage experiments had become commonplace. Scientists in many of the more than 30 BSL-4 labs around the world had used them to enhance the transmissibility of respiratory-tract pathogens.

Did the work help during the current pandemic? In a recent article in the Lancet, Colin Carlson, an expert in emerging infectious diseases at Georgetown University, argued that work funded by PREDICT helped virologists rapidly isolate and classify the SARS-CoV-2 virus when it came out. However, the research "could have been better positioned for an overall impact." Although the program found hundreds of new viruses, it's nearly impossible for scientists to assess their risk to humans. The only way to tell is to "observe a human infection."

Richard Ebright, an infectious disease expert at Rutgers, put it more bluntly. "The PREDICT program has produced no results—absolutely no results—that are of use for preventing or combating outbreaks. There's no information from that project that will contribute in any way, shape or form to addressing the outbreak at hand. The research does not provide information that's useful for developing antiviral drugs. It does not provide information that's useful for developing vaccines."

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

4ef820  No.257675

Ten years ago, the viral pathogen most in the news was not a coronavirus but influenza—in particular, a strain of flu, designated H5N1, that arose in birds and killed a high proportion of those who were infected. For a while, the virus made headlines. Then it became clear that nearly everyone who caught the bird-flu virus got it directly from handling birds. To cause a plague, it's not enough that a virus is an efficient killer. It also has to pass easily from one person to the next, a quality called transmissibility.

Around this time, Ron Fouchier, a scientist at Erasmus University in Holland, wondered what it would take for the bird flu virus to mutate into a plague virus. The question was important to the mission of virologists in anticipating human pandemics. If H5N1 were merely one or two steps away from acquiring human transmissibility, the world was in danger: a transmissible form of H5N1 could quickly balloon into a devastating pandemic on the order of the 1918 flu, which killed tens of millions of people.

To answer the question, scientists would have to breed the virus in the lab in cell cultures and see how it mutated. But this kind of work was difficult to carry out and hard to draw conclusions from. How would you know if the end result was transmissible?

The answer that Fouchier came up with was a technique known as "animal passage," in which he mutated the bird-flu virus by passing it through animals rather than cell cultures. He chose ferrets because they were widely known as a good stand-in for humans—if a virus can jump between ferrets, it is likely also to be able to jump between humans. He would infect one ferret with a bird-flu virus, wait until it got sick, and then remove a sample of the virus that had replicated in the ferret's body with a swab. As the virus multiplies in the body, it mutates slightly, so the virus that came out of the ferret was slightly different from the one that went into it. Fouchier then proceeded to play a version of telephone: he would take the virus from the first ferret and infect a second, then take the mutated virus from the second ferret and infect a third, and so on.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

4ef820  No.257676

After passing the virus through 10 ferrets, Fouchier noticed that a ferret in an adjacent cage became ill, even though the two hadn't come into contact with one another. That showed that the virus was transmissible in ferrets—and, by implication, in humans. Fouchier had succeeded in creating a potential pandemic virus in his lab.

When Fouchier submitted his animal-passage work to the journal Science in 2011, biosecurity officials in the Obama White House, worried that the dangerous pathogen could accidentally leak from Fouchier's lab, pushed for a moratorium on the research. Fouchier had done his work in BSL-2 labs, which are intended for pathogens such as staph, of moderate severity, rather than BSL-4, which are intended for Ebola and similar viruses. BSL-4 labs have elaborate safeguards—they're usually separate buildings with their own air circulation systems, airlocks and so forth. In response, the National Institutes of Health issued a moratorium on the research.

What followed was a fierce debate among scientists over the risks versus benefits of the gain-of-function research. Fouchier's work, wrote Harvard epidemiologist Marc Lipsitch in the journal Nature in 2015, "entails a unique risk that a laboratory accident could spark a pandemic, killing millions."

Lipsitch and 17 other scientists had formed the Cambridge Working Group in opposition. It issued a statement pointing out that lab accidents involving smallpox, anthrax and bird flu in the U.S. "have been accelerating and have been occurring on average over twice a week."

"Laboratory creation of highly transmissible, novel strains of dangerous viruses… poses substantially increased risks," the statement said. "An accidental infection in such a setting could trigger outbreaks that would be difficult or impossible to control. Historically, new strains of influenza, once they establish transmission in the human population, have infected a quarter or more of the world's population within two years." More than 200 scientists eventually endorsed the position.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

4ef820  No.257677

File: 73898d7ff6dc7ad⋯.jpg (389.98 KB, 1280x853, 1280:853, 20200429_113414.jpg)

The coronavirus pandemic may be a result of controversial experiments inside the Wuhan Institute of Virology, as U.S. intelligence now concedes. Chinese virologist Shi Zhengli inside the P4 laboratory in Wuhan, China, on February 23, 2017.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

4ef820  No.257678

>>257655

Of course, YOU will insist that Newsweek is not reliable, that it's 'fake news'. Meanwhile, you'll copy and paste COMPLETE TRASH from drrathfoundation.org, even though it's a well-known bullshit vitamin sales website.

https://www.newsweek.com/controversial-wuhan-lab-experiments-that-may-have-started-coronavirus-pandemic-1500503

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

4ef820  No.257679

File: 2007911e27db59c⋯.jpg (353.38 KB, 1400x1036, 50:37, 0_P7baMdixtqZtIDg3.jpg)

>>257655

>inb4 Newsweek is unreliable

"…Rath Foundation's attempt to have Achmat indicted for genocide at the international criminal court in The Hague. In February, Mr Justice Tugendhat ruled that the entire article must be considered. Had the case proceeded, the court would have been presented with details of Rath's complaint to The Hague, which called for Achmat to be permanently confined "in a small white and concrete cage, bright fluorescent light on all the time to keep an eye on him" and force-fed his Aids drugs or, "if he bites, kicks and screams too much, dripped into his arm after he's been restrained on a gurney with cable tied around his ankles, wrists and neck". The complaint was described by the Rath Foundation in January last year as "entirely valid and long overdue".

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

4ef820  No.257681

I'll put real journalists above the miasma of well-known extremist kooks with a long history of unstable behavioral patrerns, absurd claims and sales pitches

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

4ef820  No.257683

>>257655

AND FINALLY : I invite you to disprove the theory that HIV was also just another one of the thousands and thousands of viruses that was genetically altered and enhanced using GAIN OF FUNCTION protocol in a laboratory, and somehow inadvertently got released from a lab due to human error.

The problem with wild accusations and far fetched assertions is people like you and I don't have the formal education in virology, immunology, or epidemiology required to form valid opinions regarding this topic, and inherently, each of us will lean towards opinions that favor what we WANT to believe.

that's why conspiracy theorists will lean towards conspiracy theories and people like me who have studied internal medicine will lean towards scientifically sound logic.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

750817  No.257689

>>257655

The Wuhan biowarfare lab was actually funded by US taxpayers (thank the NIH for investing in Chink bioweapons like Covid-19)

http://archive.md/gK4i4 = naturalnews.com

http://archive.md/olHCK = dailymail.co.uk

https://www.naturalnews.com/2020-04-12-nih-funded-wuhan-virus-lab-research-coronavirus.html

https://www.dailymail.co.uk/news/article-8211257/Wuhan-lab-performing-experiments-bats-coronavirus-caves.html

In fact, The US State Department was also tipped off back in 2018 and refused to do anything about it:

http://archive.md/oAN9A = zerohedge.com

http://archive.md/FWaWH = washingtonpost.com

https://www.zerohedge.com/geopolitical/us-state-department-cables-warned-potential-sars-pandemic-after-visiting-wuhan-lab

https://www.washingtonpost.com/opinions/2020/04/14/state-department-cables-warned-safety-issues-wuhan-lab-studying-bat-coronaviruses/

Others knew about it before hand too (WHO):

http://archive.md/05FD3 = dailycaller.com

https://dailycaller.com/2020/04/08/national-center-for-medical-intelligence-director-counters-abc-coronavirus/

Funny how all the players involved, such as Dr. Fauci of the NIH, support ID 2020 ironically:

http://archive.md/JvD9g = zerohedge.com

http://archive.md/Y13B7 = washingtontimes.com

https://www.zerohedge.com/health/papers-please-fauci-agrees-gates-covid-immunity-card-idea-has-merit

https://www.washingtontimes.com/news/2020/apr/8/anthony-fauci-sets-stage-mandatory-vaccine/

And we all know Gates is behind it already:

http://archive.md/g0cXA = nationalfile.com

http://archive.md/nMtmy = vigilantcitizen.com

http://archive.md/bnmrh = infowars.com

https://nationalfile.com/president-trump-vs-bill-gates-on-treatment-fauci-has-a-100-million-conflict-of-interest/

https://vigilantcitizen.com/latestnews/bill-gates-calls-for-a-digital-certificate-to-identify-who-is-vaccinated/

https://www.infowars.com/bill-and-melinda-gates-foundation-others-predicted-up-to-65-million-deaths-via-coronavirus-in-simulation-ran-3-months-ago/

Their official agenda website: https://id2020.org/alliance [http://archive.md/ZNRGI]

THE BILL AND MELINDA GATES FOUNDATION, THE WHO, AND WUHAN LAB WERE HACKED RECENTLY!

https://www.bitchute.com/video/CtYqFa5voFiq/

Here are some of the documents that were stolen during the hack: https://archive.is/slBtQ

https://web.archive.org/web/20200425163938/https://imgur.com/a/3dgCksD

Note we can clearly see in a couple pics they KNEW this was bio-engineered, with HIV RNA transmission sequences.

Wuhan Bioweapon Lab Email Passwords:

http://archive.md/1dxFa

WHO Email Passwords:

https://archive.md/JIJ2b

Gates Foundation Email Passwords:

https://archive.md/j6sgo

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

e25580  No.257694

>>257689

beforehand is one word, not two

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

e25580  No.257695

>>257689

you cannot produce even one teeny tiny shred of evidence that SARS-CoV-2 has any correlation with HIV whatsoever

(copying and pasting isn't evidence)

you're completely unknowledgeable about the topic, but you pretend to be an expert, as if your hand-me-down second-rate theories have any value.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

e25580  No.257696

>>257689

by the way, as an American taxpaying citizen, I am obligated to report you for trying to invite a conspiracy to commit a federal offense by posting links to alleged 'email passwords' online.

you quite literally just fucked up.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

53d959  No.257697

>>257689

one minute, you claim it's a BIOWEAPON

the next, you claim it was a VACCINE

you're all over the place, schizo

pick one, make up your mind, and take Seroquel

(your daughter is finally done with you)

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

53d959  No.257698

I just got the Dept of Homeland Security website.

Now I've got no choice but to send them about >>257689 posting alleged email passwords

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

bd7982  No.257699

>>257696

Your an idiot who is out-of-date and completely uninformed. Those emails leaked a week ago! They have already spread EVERYWHERE. Their servers were already hacked, and later patched! The docs a juicy though! I linked to some pics of those, and YES, the feds should look at those! Hahaha! Then they'll KNOW it's a bioweapon and (((WHO))) covered the whole thing up lol! And they'll find even more too…. :)

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

87020a  No.257700

>>257697

It is a bioweapon. Their vaccine was planned BEFORE the bioweapon (corona) was released from the lab! Yes, all planned to happen, 3+ months in advance! And Fauci? He worked for the Gates Foundation on the vaccine lol!!! He's making money off this! They all knew in advance, because the NIH (run under Fauci at that time!) literally sent US taxpayer money to help fund the Wuhan Bioweapons lab baby!!

Say it ain't so!

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

f36a95  No.257701

>>257699

it's hilarious when an adult who can't spell YOU'RE correctly calls ME an idiot.

RE: your assertions

PROVE IT

tell me the technical details of inserting HIV

tell me how to insert genetic sequences

tell me the names of the technicians

tell me the exact dates

tell me what you KNOW

not what you copy & paste

(without actually understanding any of it)

HINT: maybe you should learn how to differentiate between YOUR and YOU'RE before you try learning virology?

FACT: you actually have NO IDEA wtf you're talking about, because you have NO EVIDENCE, just your predictable endless boring copied & pasted bullshit that has ZERO VALUE

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

f36a95  No.257702

>>257700

you don't know what a BSL-2 LAB is

you don't even know what it means

you don't know what a BSL-4LAB is

you don't know what the PREDICT PROGRAM is

you don't know the number of PREDICT Labs

you don't know their locations

all you know is copy & paste

copy & paste

copy & paste

copy & paste

copy & paste

copy & paste

copy & paste

copy & paste

copy & paste

copy & paste

copy & paste

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

2bb2e1  No.257703

>>257702

I wouldn't have to save & copy/paste this info if people like you would just CLICK & READ THE DAMN LINKS! Everything is in those links you need to know. Well, most of it. Event 201. The patents. The leaked documents! NIH funding under Fauci to the bioweapons lab in Wuhan China and his association to the Bill & Melinda Gates Foundation before the outbreak. The Gates Foundation planning the vaccine before the outbreak (ID 2020)! The US State Department was tipped off about nefarious activity back in 2018 for Christ sake! Just investigate the links I gave you, it's all there!

Over, I got drinkin to do!!!!

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

abaf1c  No.257704

IMPORTANT UPDATE:

you never preface your statements with

"I think" or "I believe"

you never have the courage to admit

"I am predisposed to believing in far fetched conspiracy theories"

you NEVER preface anything with

"I really don't know, but I look for websites that seem to validate my obsessive need to claim things are evil plots"

you never NEVER admit the truth……

that you actually have no proof at all

because you're dishonest

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

abaf1c  No.257705

>>257703

nobody clicks your links

your copy & pasted links

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

5c8513  No.257707

>>257689

Anything that you have 'archived' is just pure trash

Nothing from zerohedge has any merit whatsoever

None of your conspiracy theory websites have any merit or value

The Washington Times has merit, and if you'll notice their headlines don't match your conspiracy theory bullshit

and "we all know" ?….

WE WHO ??? WHO IS 'WE' ???

YOU DON'T ACTUALLY KNOW ANYTHING

You weren't there

You weren't involved

You have no actual first-hand knowledge at all

You Don't Know Jack Shit

You simply THINK you know

(but nobody else thinks you know)

you're the only one who actually

thinks other people think that

you KNOW, but we all know

that you DON'T know

you still can't provide even the teeniest tiniest little shred of evidence whatsoever

I keep asking you to provide actual tangible evidence

and you keep trying to change the subject and distract and use misdirection

But you can't provide any evidence at all

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

5c8513  No.257708

File: 25dbf192ada70ac⋯.png (426.59 KB, 809x1280, 809:1280, 20200429_215309.png)

Copying and pasting boring links is not evidence

You don't have any tangible knowledge whatsoever

and you DO NOT KNOW anything

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

5c8513  No.257709

if only you knew how NOT bad it really is

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

7f0eb0  No.257710

>>257683

>Being a verbose nigger making wild accusations without actually making a point just stroking your own ego.

Yeah your psychological profiling is amazing Doc. Not saying OP isn't a fag your just one too. DEFINITELY believe you are in academia though.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

5c8513  No.257711

File: be773b0a5db1a70⋯.png (762.34 KB, 2160x1080, 2:1, Screenshot_2020_04_29_22_0….png)

hahaha that video was produced by RAIR (Resistance Against Islamic Radicals) a well known hate group which consists of some of the stupidest idiots on Earth.

and it was translated by MISS PIGGY

wow, you sure do know how to discredit yourself

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

5c8513  No.257712

File: dae0c2aa03372b2⋯.jpg (47.94 KB, 1280x453, 1280:453, 20200429_221822.jpg)

hint: the opinions and beliefs of illiterate adults are irrelevant. when somebody is incapable of learning the difference between YOUR and YOU'RE, their thought process is clearly not worthy of acknowledging

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

5c8513  No.257713

>>257710

I never said I was in academia, or that I'm a doctor.

I simply said that I've studied internal medicine

extensively, in fact

(let me know when you have some spare time, and I'll gladly teach you the difference between your and you're)

genius

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

850c45  No.257714

>>257713

>I simply said that I've studied internal medicine

OK, then you know boosting your immune system is the very best thing you can do!! Otherwise your so-called 'degree' ain't worth jack shit!!! I've lived enough to know myself! In fact, if I listened to you so-called 'professionals' many years ago, I'd be DEAD by now "from drinking myself to death!" Ahhhhhh! Too bad I found detox and vitamins to keep me alive for YEARS going!!!!!

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

ef2c96  No.257715

There was an old man who lived in a shoe.

She had so many toasters, he didn't know what to do.

He copied & pasted what others had said,

And pretended that he had said it instead.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

ef2c96  No.257716

>>257714

you call THAT living?

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

ef2c96  No.257723

>>257714

You won't even admit that you got a BCG inoculation back in the 1960s

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

43b9f5  No.257731

>>257689

Smart guy who loves his country ^^^

>>257696

Douchebag Jew lawyer or Chinese sympathizer (I always figured the two where the same since the Chinese financial minister has been Jewish since before Mao Ze Dong) who loves lording his power over the average U S. citizen, ironic considering if he is a U.S Citizen, shouldn't he believe in the perspective of Freedom to Speech and Expression? Just a few logical thoughts…

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

43b9f5  No.257732

>>257708

Actually, the links and compilation is all there lol. How can you say he doesn't have anything? You people come out and say it every chance you get. I could spend weeks digging up videos from the 70's to present day from Henry Kissinger to Bill Gates about their grand interests in Eugenics. Come on now misinformation bro, why you lie to people? You know it is bad, yet you do it?

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

43b9f5  No.257734

>>257705

>>257707

ROFL, you're so mad that the truth was posted 😂😂😂. I love y'all anti information NPC's.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

43b9f5  No.257736

>>257707

Why would you accuse someone of what YOU'RE doing, you're literally a misinformation campaign.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

37866f  No.257737

>>257716

Yes, to live a little you have to drink and do drugs, sorry if that offends you so much. PS: I don't do drugs anymore! I just have some bad alcoholism today! I've tried quitting cold turkey more times than you could imagine!

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

0f0ce0  No.257739

>>257737

that's weird. I was able to quit cold turkey after 40 years of hardcore drug abuse.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

52ee2d  No.257740

>>257739

I used to sniff dimes and 8balls almost daily and did amphetamine before going to work sometimes too. I had NO withdrawal what-so-ever when I quite (other than thinking about it from time to time)!! No problem quitting that stuff. But for some strange reason alcohol is extremely addictive for me. I will literally hear demonic voices inside my skull if I don't drink for a while! It is the worst drug, by far, I have ever done really.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

432de6  No.257743

>>257740

hearing 'demonic voices in your head' is NOT associated with cocaine, or any other drug for that matter.

hearing demonic voices in your head INDEED IS the primary symptom of organic schizophrenia

I'm not being mean or insulting you, I'm simply explaining the symptomology of schizophrenia, an organic psychiatric disorder.

hearing ANY voices in your head = schizophrenia

'demonic' is a term used by people who have been conditioned (brainwashed in their youth) to believe in 'god'

if it weren't for the religious brainwashing, you'd never have the term 'demons' in your vocabulary

apparently, the cocaine triggered an underlying preexisting psychiatric disorder

because although cocaine is a completely worthless shitty drug, hundreds of millions of people use it without ever experiencing any voices in their heads

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

432de6  No.257744

'hearing demonic voices in your head unless you self-medicate with alcohol' = admitting that you have organic schizophrenia and you use alcohol instead of anti-psychotic medication

There's a reason they call the medicine 'antipsychotics'…….

Because schizophrenia is psychosis

Because you're psychotic, quite literally… It's not an insult… It's simply a medical diagnosis… You have openly admitted that you suffer from psychosis

(And when somebody suffering from psychosis tells you about conspiracy theories, those conspiracy theories have absolutely no value or basis in reality whatsoever)

Your conspiracy theories are simply I'm just another one of your many symptoms of schizophrenia and uncontrolled psychotic episodes, which you self-medicate with alcohol, thereby making your belief system even that much less valuable

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

432de6  No.257745

HINT: psychologically stable people DO NOT hear voices in their heads

Hearing voices in your head is exclusively for schizophrenics

psychologically stable people do NOT ever hear voices…. never….. not ever….

all doctors and psychiatrists and psychologists and social workers know that if somebody mentions 'voices in their heads', that person has schizophrenia

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

432de6  No.257747

HINT: if you raised a child from birth, without ever exposing the child to religion, the child would become an adult, and never have a concept of 'demons'

if you raised 10 children from birth, without ever exposing the children to religion, the children would become adults, and never have a concept of 'demons'

if you raised 100 children from birth, without ever exposing the children to religion, the children would become adults, and never have a concept of 'demons'

if you raised 1,000 children from birth, without ever exposing the children to religion, the children would become adults, and never have a concept of 'demons'

if you raised 10,000 children from birth, without ever exposing the children to religion, the children would become adults, and never have a concept of 'demons'

if you raised 100,000 children from birth, without ever exposing the children to religion, the children would become adults, and never have a concept of 'demons'

if you raised 1,000,000 children from birth, without ever exposing the children to religion, the children would become adults, and never have a concept of 'demons'

if you raised 1,000,000,000 children from birth, without ever exposing the children to religion, the children would become adults, and never have a concept of 'demons'

because 'demons' aren't real

it's all in your head, like the voices

and your religion proves that you are predisposed to believing in imaginary nonsense

just like all of your imaginary conspiracies

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

432de6  No.257748

HINT: when trying to convince other people to believe in your far-fetched absurd conspiracy theories, try NOT admitting that you suffer from schizophrenia and alcoholism

the admitted psychiatric disorder and uncontrollable addiction problem completely discredit anything you say

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

432de6  No.257750

For example :

Luc Montagnier's hair

look at his hair in the shitty video

when he turns his head to the side, you can see that his hair is actually a horrible shade of grey, because he's so old

he has dyed his hair brown

but only the front half of his hair

when he turns his head to the side, you can see that he has left the back of his head undyed

it's really quite bizarre

in fact, it highlights the fact that his hair dye isn't even real hair dye. it's like some kind of weird 'hair paint' he hurredly applied to his head

trying to appear younger, smarter, more viable

trying to be something he's not

because he's NOT in the loop anymore

he's washed up

he's an old, washed up fool

who admits in the video that he hasn't done ANY real hands on research on this virus

that his 'knowledge' about the virus is limited to sitting on a computer

He HAS NOT done any gene sequencing on the virus at all

he's an insane old fool

and all of his colleagues laugh at him

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

07c04a  No.257751

Luc Montagnier is an old kook

he's a clown

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

80416b  No.257752

File: bb76815eb677f4e⋯.png (2.07 MB, 2160x1080, 2:1, Screenshot_2020_04_30_11_2….png)

a sane person doesn't dye their hair like this

this reminds me of 'the crazy old woman' that walks down the street, hair halfway dyed, tons of crazy makeup around her eyes, too much lipstick not confined to the boundaries of her lips, wearing multiple layers of coats and jackets, talking to herself while she pushes a cat in a shopping cart down the sidewalk….

a kook

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

305a32  No.257757

File: 7fdd47c7808de6a⋯.jpg (245.97 KB, 1919x1080, 1919:1080, PicsArt_04_30_01_09_37.jpg)

>>257655

Seasons change…

People change….

He used to be well respected….

but now he's a fucking joke

an old, washed up clown

And the only people who listen to him now are conspiracy theory nut jobs

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

305a32  No.257758

I can name off 25 other world-renowned preeminent virologists who AREN'T old washed up kooks, who have carefully studied the gene sequencing, and who say NO, THERE ISN'T ANY INDICATION OF GENETIC MANIPULATION IN SARS-COV-2

of course, if you wanted to prove them wrong, you could always post the gene sequence of this virus, and show us exactly where this alleged 'manipulation' can be seen.

in other words, PROVE IT or stfu

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

305a32  No.257760

>>257740

when you obtained the complete genome sequence of SARS-CoV-2, family Coronaviridae, genus Betacoronavirus, by

conducting the real-time reverse transcriptase PCR (rRT-PCR) did you use the Illumina MiSeq system with the Burrows-Wheeler Aligner MEM algorithm (BWA-MEM) 0.7.5a-r405 assembly method?

Did you amplify the full genome directly from the RNA extract from the original specimen using gene-specific primers for open reading frame 1b (ORF1b) and N to produce overlapping PCR products covering the full genome ?

Where the expected amplicon sizes of the ORF1b and N gene assays 132 bp and 110 bp, respectively ?

Where the raw reads were first cleaned by trimming low-quality bases with Trimmomatic 0.36 (-phred33, LEADING:20, TRAILING:20, SLIDINGWINDOW:4:20, MINLEN:40) ?

Was the new genome sequence obtained by first mapping reads to a reference SARS-CoV-2 genome using BWA-MEM 0.7.5a-r405 with default parameters to generate the consensus sequence?

Was the assembly produced by MEGAHIT 1.2.9 (de novo assembly), using default parameters, was used to cross-validate with the reference-based method as an internal control ?

We're the two results consistent, and your final sequence based on the reference-based method?

Was the reference sequence you used from the Global Initiative on Sharing All Influenza Database (GISAID; strain identifier EPI_ISL_405839) ?

Was your resulting sequence curated in a pileup alignment file to obtain the consensus sequence (minimum coverage threshold, 10) with FastQC 0.11.8 used to assess the sequence quality before trimming and after alignment to prevent potential errors ?

Was a total of 9,891,431 records included in your reference-based alignment after trimming, and 9,887,093 (99.96%) of them mapped to the SARS-CoV-2 reference genome?

….or are you just completely full of shit, and don't actually know a god damn thing about the genetic sequencing of ribonucleic acid?

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

cf15f9  No.257761

>>257740

Here's the complete coding sequence of SARS-CoV-2:

MESLVPGFNEKTHVQLSLPVLQVRDVLVRGFGDSVEEVLHLKDGTCGLVEVEKGVLPQLEQPYVFIKRSDARTAPHGHVMVELVAELEGIQYGRSGETLGVLVPHVGEIPVAYRKVLLRKNGNKGAGGHSYGADLKSFDLGDELGTDPYEDFQENWNTKHSSGVTRELMRELNGGAYTRYVDNNFCGPDGYPLECIKDLLARAGKASCTLSEQLDFIDTKRGVYCCREHEHEIAWYTERSEKSYELQTPFEIKLAKKFDTFNGECPNFVFPLNSIIKTIQPRVEKKKLDGFMGRIRSVYPVASPNECNQMCLSTLMKCDHCGETSWQTGDFVKATCEFCGTENLTKEGATTCGYLPQNAVVKIYCPACHNSEVGPEHSLAEYHNESGLKTILRKGGRTIAFGGCVFSYVGCHNKCAYWVPRASANIGCNHTGVVGEGSEGLNDNLLEILQKEKVNINIVGDFKLNEEIAIILASFSASTSAFVETVKGLDYKAFKQIVESCGNFKVTKGKAKKGAWNIGEQKSILSPLYAFASEAARVVRSIFSRTLETAQNSVRVLQKAAITILDGISQYSLRLIDAMMFTSDLATNNLVVMAYITGGVVQLTSQWLTNIFGTVYEKLKPVLDWLEEKFKEGVEFLRDGWEIVKFISTCACEIVGGQIVTCAKEIKESVQTFFKLVNKFLALCADSIIIGGAKLKALNLGETFVTHSKGLYRKCVKSREETGLLMPLKAPKEIIFLEGETLPTEVLTEEVVLKTGDLQPLEQPTSEAVEAPLVGTPVCINGLMLLEIKDTEKYCALAPNMMVTNNTFTLKGGAPTKVTFGDDTVIEVQGYKSVNITFELDERIDKVLNEKCSAYTVELGTEVNEFACVVADAVIKTLQPVSELLTPLGIDLDEWSMATYYLFDESGEFKLASHMYCSFYPPDEDEEEGDCEEEEFEPSTQYEYGTEDDYQGKPLEFGATSAALQPEEEQEEDWLDDDSQQTVGQQDGSEDNQTTTIQTIVEVQPQLEMELTPVVQTIEVNSFSGYLKLTDNVYIKNADIVEEAKKVKPTVVVNAANVYLKHGGGVAGALNKATNNAMQVESDDYIATNGPLKVGGSCVLSGHNLAKHCLHVVGPNVNKGEDIQLLKSAYENFNQHEVLLAPLLSAGIFGADPIHSLRVCVDTVRTNVYLAVFDKNLYDKLVSSFLEMKSEKQVEQKIAEIPKEEVKPFITESKPSVEQRKQDDKKIKACVEEVTTTLEETKFLTENLLLYIDINGN

LHPDSATLVSDIDITFLKKDAPYIVGDVVQEGVLTAVVIPTKKAGGTTEMLAKALRKVPTDNYITTYPGQGLNGYTVEEAKTVLKKCKSAFYILPSIISNEKQEILGTVSWNLREMLAHAEETRKLMPVCVETKAIVSTIQRKYKGIKIQEGVVDYGARFYFYTSKTTVASLINTLNDLNETLVTMPLGYVTHGLNLEEAARYMRSLKVPATVSVSSPDAVTAYNGYLTSSSKTPEEHFIETISLAGSYKDWSYSGQSTQLGIEFLKRGDKSVYYTSNPTTFHLDGEVITFDNLKTLLSLREVRTIKVFTTVDNINLHTQVVDMSMTYGQQFGPTYLDGADVTKIKPHNSHEGKTFYVLPNDDTLRVEAFEYYHTTDPSFLGRYMSALNHTKKWKYPQVNGLTSIKWADNNCYLATALLTLQQIELKFNPPALQDAYYRARAGEAANFCALILAYCNKTVGELGDVRETMSYLFQHANLDSCKRVLNVVCKTCGQQQTTLKGVEAVMYMGTLSYEQFKKGVQ

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

cf15f9  No.257762

>>257740

Please feel free to browse the gene sequence of the RNA, and point out the part that contains the HIV insert…

I'm sure you won't have any problem finding it

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

e9979a  No.257770

File: 716af21f5434519⋯.jpg (49.63 KB, 611x583, 611:583, 1588265927688.jpg)

>>257656

wow wtf I love china now!

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

e9979a  No.257771

File: 2e4af064bba4f7a⋯.png (623.05 KB, 1282x318, 641:159, hmm.png)

>get bored of 4cuck

>come here

>this entire thread is nothing but chinese shills doing pic related

holy shit

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

740c2c  No.257774

Holy shit, just got back from my new landscaping job and here to post more news bombs again…. low and behold Johnny is sperging out again! lol Don't know what to comment on first.

>>257745

No, that doesn't happen all the time. Just when I don't drink for a real long while (give or take, two weeks then I start having trouble sleeping and hearing demonic entities saying cruel things, I won't even get into it). When I drink – even if it's only getting drunk once a week – I am perfectly normal!

>>257760

Ok…. I just use 10W30 oil for my wood chipper engine…..

>>257762

Natural News posted a mirrored link to it before, with the whole p-Shuffle-n signature which exposed it being engineered. Even a scientific study backing it (oh, which was taken down because of the US, China and WHO being bullies of the world!) Again. Event 201. ID 2020. Fauci helped head the whole goal of this vaccine up to a YEAR before the bioweapon was released! Helped the NIH fund the bioweapons lab in China. So whatever, I don't trust them at all!!! I'm NOT getting tested and I'm not taking those tainted vaccines!!

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

7f883f  No.257779

>>257689

thanks anon, the amount of shill/bot replies like:

>>257707

"Nothing from zerohedge has any merit whatsoever" (topkek)

really shows your post is highly butthurt-inducing

These shills have really gone down in quality since the last time I was here, must be a different group (chinese? probably)

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

7f883f  No.257780

>>257771

Are the chinks worse than the jews? They seem to be more totalitarian but way less smart (or maybe they just can't write English or lack the cultural context)

They at least seem less mean, like if they have good better than outright "muh chosen people = good; everyone else = the Goyim (translation: animals or cattle, to be treated as such/in whichever way benefits (((them))) the most)" intentions - but, of course, they are still obviously attempting to conceal the truth, which is very obviously evil, (well, it's only obvious to someone if they don't live in perpetual cognitive dissonance, just as the jews live in cognitive dissonance: hating nazis/white supremacists so much despite their entire religion being literally the exact same thing)

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

b70bc9  No.257781

File: 089ff500503cd06⋯.png (1.18 MB, 1169x1057, 167:151, PicsArt_04_30_01_46_09.png)

Dammit!

Looks like I missed out on all the fun while I was busying myself copying and pasting endless embeds no one will ever watch, but should, over at >>>/freedomzine/1993 for Johnny & Killcen's viewing pleasure…

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

7f883f  No.257782

Hey shills, what are you trying to protect? What are your values? What is the point of protecting liars that got so many people killed? Are those the kinds of people you want to serve?

You can expose them, let the world know what they've done… Tell the truth and overthrow your evil leaders.

Nobody can rule forever… They are not immune to damage… otherwise they wouldn't have hired you to protect them. They DEPEND ON YOU, you are their sword against the people. You do not have to work for them anymore - work for Good, YOUR OWN DEFINITION OF GOOD. Nobody else can tell you what's right and what's wrong. Do what YOU think is right, not what you're told to do (after all, that depends on someone else's definition of good). Would you rather trust their definition or YOUR definition? Believe that you can tell the difference between right and wrong. I know you can. Please don't let all these people die while the murderers get away with it scot free.

You are never alone, everybody in the West thinks like this. You are one of us if you want to. You too can be free.

Free from tyranny and oppression. Free from blind obedience. Free to choose your opinions; who you love, who you hate. You don't have to worship any God or follow any man. YOU make your own opinions.

Fight for FREEDOM, fight for JUSTICE and for THE TRUTH. This is what it means to be a European, this is what it means to be an American.

Will you join us? Or will you sit there in your pathetic slavery, obeying a leader who doesn't even care about you? OBEY YOUR OWN SELF, OBEY YOUR OWN SENSE OF RIGHT AND WRONG. You know what's right, and you know this isn't right. Do something you can follow whole heartedly. DO WHAT'S RIGHT - I KNOW YOU CAN DO BETTER FOR YOUR SELF, FOR YOUR COUNTRY AND FOR HUMANITY- I KNOW YOU CAN DO BETTER THAN WHATEVER IT IS YOU'RE CURRENTLY DOING, AND I KNOW THAT YOU KNOW IT TOO.

Writing comments on the internet to help protect murderers & liars? I know that you know that you could be doing infinitely better than that. Become the best possible version of yourself, PLUS ULTRA

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

b70bc9  No.257783

File: db40d02baca3c50⋯.jpg (44.35 KB, 480x250, 48:25, PicsArt_04_30_06_41_01.jpg)

>>257782

A "noble" effort.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

ee0cfb  No.257784

>>257774

So what you're saying is the reference sequence you used from the Global Initiative on Sharing All Influenza Database (GISAID; strain identifier EPI_ISL_405839) is how you found the genetic sequencing of HIV that was inserted into the SARS-CoV-2 Virion ?

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

ee0cfb  No.257785

>>257779

ZseroHedge is trash

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

7f883f  No.257786

>>257785

>ZeroHedge is trash

>[that's the whole comment]

That really convinced me, never going to ZeroHedge ever again. What news sources would (((you))) recommend?

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

369629  No.257787

>>257785

Zerohedge is a great news aggregation site and I will continue to read their articles and not give a flying fuck if others don't like me doing so!!

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

369629  No.257788

>>257784

It will take me about 5+ minutes to find this report fucker, so this better please you it won't because nothing ever will!

http://archive.md/x8heo

https://www.naturalnews.com/2020-02-02-coronavirus-bioweapon-chinese-vaccine-experiment-gone-wrong-pshuttle-sn-gene-sequence.html

By the way, this has been the most targeted censored article in almost every search engine out there! Thank God I have one alternative in which I will NEVER name because it is not controlled yet!

Thank you, I will add this to my offline WAR CRIMES archive underground faraday caged backup, and make sure to spread it far and wide because Big Tech (govt-industry) is trying their best to hide this report!!!

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

369629  No.257789

Most Censored Report On Web Search Engines Today! This Is Being Removed From Search Results By Big Tech!

http://archive.md/x8heo

https://www.naturalnews.com/2020-02-02-coronavirus-bioweapon-chinese-vaccine-experiment-gone-wrong-pshuttle-sn-gene-sequence.html

https://web.archive.org/web/20200501040515/https://www.naturalnews.com/2020-02-02-coronavirus-bioweapon-chinese-vaccine-experiment-gone-wrong-pshuttle-sn-gene-sequence.html

This is now archived FOREVER. On paper too. On disc medium. To be on floppy soon. And report + links will be spread throughout 10,000+ pastebins and all archived very soon!

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

c7ba9d  No.257796

>>257788

Naturalnews makes zerohedge almost seem legitimate

and ZseroHedge is GARBAGE

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

c7ba9d  No.257797

Which came first, the chicken or the schizophrenia?

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

e020ee  No.257802

AGAIN: NOBODY EVER CLICKS YOUR LINKS

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

e020ee  No.257803

Archiving Links :

The Cyber equivalent of you hoarding, saving every empty can of rationed pork & beans, every empty plastic wrapper from every candybar you've ever eaten, every empty plastic wrapper to every pack of toilet paper.

You're a HOARDER, and it's all trash.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

e020ee  No.257804

>>257787

C O R R E C T I O N :

ZeroHedge is completely disreputable, not a legitimate news organization, total rubbish.

It's nothing but a series of one idiotic far-fetched conspiracy theory after another, none of which are verifiable.

'news' for those who are willing to pretend it's news

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

e020ee  No.257805

>>257782

Ahhhh, the lonely, isolated, unaccomplished, marginalized, disenfranchised little man wants to pretend that he's 'part of a large, all knowing organization'….

hahahaha GO CLEAN YOUR ROOM, OR ILL BREAK YOUR XBOX

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

e020ee  No.257806

>>257655

again: here's the COVID-19 gene sequence

MESLVPGFNEKTHVQLSLPVLQVRDVLVRGFGDSVEEVLHLKDGTCGLVEVEKGVLPQLEQPYVFIKRSDARTAPHGHVMVELVAELEGIQYGRSGETLGVLVPHVGEIPVAYRKVLLRKNGNKGAGGHSYGADLKSFDLGDELGTDPYEDFQENWNTKHSSGVTRELMRELNGGAYTRYVDNNFCGPDGYPLECIKDLLARAGKASCTLSEQLDFIDTKRGVYCCREHEHEIAWYTERSEKSYELQTPFEIKLAKKFDTFNGECPNFVFPLNSIIKTIQPRVEKKKLDGFMGRIRSVYPVASPNECNQMCLSTLMKCDHCGETSWQTGDFVKATCEFCGTENLTKEGATTCGYLPQNAVVKIYCPACHNSEVGPEHSLAEYHNESGLKTILRKGGRTIAFGGCVFSYVGCHNKCAYWVPRASANIGCNHTGVVGEGSEGLNDNLLEILQKEKVNINIVGDFKLNEEIAIILASFSASTSAFVETVKGLDYKAFKQIVESCGNFKVTKGKAKKGAWNIGEQKSILSPLYAFASEAARVVRSIFSRTLETAQNSVRVLQKAAITILDGISQYSLRLIDAMMFTSDLATNNLVVMAYITGGVVQLTSQWLTNIFGTVYEKLKPVLDWLEEKFKEGVEFLRDGWEIVKFISTCACEIVGGQIVTCAKEIKESVQTFFKLVNKFLALCADSIIIGGAKLKALNLGETFVTHSKGLYRKCVKSREETGLLMPLKAPKEIIFLEGETLPTEVLTEEVVLKTGDLQPLEQPTSEAVEAPLVGTPVCINGLMLLEIKDTEKYCALAPNMMVTNNTFTLKGGAPTKVTFGDDTVIEVQGYKSVNITFELDERIDKVLNEKCSAYTVELGTEVNEFACVVADAVIKTLQPVSELLTPLGIDLDEWSMATYYLFDESGEFKLASHMYCSFYPPDEDEEEGDCEEEEFEPSTQYEYGTEDDYQGKPLEFGATSAALQPEEEQEEDWLDDDSQQTVGQQDGSEDNQTTTIQTIVEVQPQLEMELTPVVQTIEVNSFSGYLKLTDNVYIKNADIVEEAKKVKPTVVVNAANVYLKHGGGVAGALNKATNNAMQVESDDYIATNGPLKVGGSCVLSGHNLAKHCLHVVGPNVNKGEDIQLLKSAYENFNQHEVLLAPLLSAGIFGADPIHSLRVCVDTVRTNVYLAVFDKNLYDKLVSSFLEMKSEKQVEQKIAEIPKEEVKPFITESKPSVEQRKQDDKKIKACVEEVTTTLEEMESLVPGFNEKTHVQLSLPVLQVRDVLVRGFGDSVEEVLHLKDGTCGLVEVEKGVLPQLEQPYVFIKRSDARTAPHGHVMVELVAELEGIQYGRSGETLGVLVPHVGEIPVAYRKVLLRKNGNKGAGGHSYGADLKSFDLGDELGTDPYEDFQENWNTKHSSGVTRELMRELNGGAYTRYVDNNFCGPDGYPLECIKDLLARAGKASCTLSEQLDFIDTKRGVYCCREHEHEIAWYTERSEKSYELQTPFEIKLAKKFDTFNGECPNFVFPLNSIIKTIQPRVEKKKLDGFMGRIRSVYPVASPNECNQMCLSTLMKCDHCGETSWQTGDFVKATCEFCGTENLTKEGATTCGYLPQNAVVKIYCPACHNSEVGPEHSLAEYHNESGLKTILRKGGRTIAFGGCVFSYVGCHNKCAYWVPRASANIGCNHTGVVGEGSEGLNDNLLEILQKEKVNINIVGDFKLNEEIAIILASFSASTSAFVETVKGLDYKAFKQIVESCGNFKVTKGKAKKGAWNIGEQKSILSPLYAFASEAARVVRSIFSRTLETAQNSVRVLQKAAITILDGISQYSLRLIDAMMFTSDLATNNLVVMAYITGGVVQLTSQWLTNIFGTVYEKLKPVLDWLEEKFKEGVEFLRDGWEIVKFISTCACEIVGGQIVTCAKEIKESVQTFFKLVNKFLALCADSIIIGGAKLKALNLGETFVTHSKGLYRKCVKSREETGLLMPLKAPKEIIFLEGETLPTEVLTEEVVLKTGDLQPLEQPTSEAVEAPLVGTPVCINGLMLLEIKDTEKYCALAPNMMVTNNTFTLKGGAPTKVTFGDDTVIEVQGYKSVNITFELDERIDKVLNEKCSAYTVELGTEVNEFACVVADAVIKTLQPVSELLTPLGIDLDEWSMATYYLFDESGEFKLASHMYCSFYPPDEDEEEGDCEEEEFEPSTQYEYGTEDDYQGKPLEFGATSAALQPEEEQEEDWLDDDSQQTVGQQDGSEDNQTTTIQTIVEVQPQLEMELTPVVQTIEVNSFSGYLKLTDNVYIKNADIVEEAKKVKPTVVVNAANVYLKHGGGVAGALNKATNNAMQVESDDYIATNGPLKVGGSCVLSGHNLAKHCLHVVGPNVNKGEDIQLLKSAYENFNQHEVLLAPLLSAGIFGADPIHSLRVCVDTVRTNVYLAVFDKNLYDKLVSSFLEMKSEKQVEQKIAEIPKEEVKPFITESKPSVEQRKQDDKKIMESLVPGFNEKTHVQLSLPVLQVRDVLVRGFGDSVEEVLHLKDGTCGLVEVEKGVLPQLEQPYVFIKRSDARTAPHGHVMVELVAELEGIQYGRSGETLGVLVPHVGEIPVAYRKVLLRKNGNKGAGGHSYGADLKSFDLGDELGTDPYEDFQENWNTKHSSGVTRELMRELNGGAYTRYVDNNFCGPDGYPLECIKDLLARAGKASCTLSEQLDFIDTKRGVYCCREHEHEIAWYTERSEKSYELQTPFEIKLAKKFDTFNGECPNFVFPLNSIIKTIQPRVEKKKLDGFMGRIRSVYPVASPNECNQMCLSTLMKCDHCGETSWQTGDFVKATCEFCGTENLTKEGATTCGYLPQNAVVKIYCPACHNSEVGPEHSLAEYHNESGLKTILRKGGRTIAFGGCVFSYVGCHNKCAYWVPRASANIGCNHTGVVGEGSEGLNDNLLEILQKEKVNINIVGDFKLNEEIAIILASFSASTSAFVETVKGLDYKAFKQIVESCGNFKVTKGKAKKGAWNIGEQKSILSPLYAFASEAARVVRSIFSRTLETAQNSVRVLQKAAITILDGISQYSLRLIDAMMFTSDLATNNLVVMAYITGGVVQLTSQWLTNIFGTVYEKLKPVLDWLEEKFKEGVEFLRDGWEIVKFISTCACEIVGGQIVTCAKEIKESVQTFFKLVNKFLALCADSIIIGGAKLKALNLGETFVTHSKGLYRKCVKSREETGLLMPLKAPKEIIFLEGETLPTEVLTEEVVLKTGDLQPLEQPTSEAVEAPLVGTPVCINGLMLLEIKDTEKYCALAPNMMVTNNTFTLKGGAPTKVTFGDDTVIEVQGYKSVNITFELDERIDKVLNEKCSAYTVELGTEVNEFACVVADAVIKTLQPVSELLTPLGIDLDEWSMATYYLFDESGEFKLASHMYCSFYPPDEDEEEGDCEEEEFEPSTQYEYGTEDDYQGKPLEFGATSAALQPEEEQEEDWLDDDSQQTVGQQDGSEDNQTTTIQTIVEVQPQLEMELTPVVQTIEVNSFSGYLKLTDNVYIKNADIVEEAKKVKPTVVVNAANVYLKHGGGVAGALNKATNNAMQVESDDYIATNGPLKVGGSCVLSGHNLAKHCLHVVGPNVNKGEDIQLLKSAYENFNQHEVLLAPLLSAGIFGADPIHSLRVCVDTVRTNVYLAVFDKNLYDKLVSSFLEMKSEKQVEQKIAEIPKEEVKPFITESKPSVEQRKQDDKKIKACVEEVTTTLEETKFLTENLLLYIDINGNKACVEEVTTTLEETKFLTENLLLYIDINGN

please point out the HIV sequence

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

3cde67  No.257808

File: 1a89dd3dd956f61⋯.png (694.05 KB, 1080x2160, 1:2, Screenshot_2020_05_01_09_2….png)

>>257655

I've taken the liberty of reporting every copy of this video to YouTube for removal, due to him giving false unverifiable misinformation about the pandemic.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

3cde67  No.257810

File: d20525a3267a56a⋯.png (1.14 MB, 1080x2160, 1:2, Screenshot_2020_05_01_09_2….png)

Although this same video was found all over other YouTube channels, (and I reported them all to be banned)

I particularly wanted to focus on YOUR LINK

the RathFoundation Link

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

3cde67  No.257811

File: c9a0b887fd64c80⋯.png (646.97 KB, 1080x2160, 1:2, Screenshot_2020_05_01_09_2….png)

>>257655

YouTube has a new policy of banning misleading content about COVID19

so I went ahead and reported your link for permanent removal

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

3cde67  No.257812

>>257655

There!! All done !!

I just finished emailing YouTube support, explaining how the RairFoundation channel's copy of the Luc Montagnier interview was spreading unverified rumors about COVID19, trying to spread fear, and how RairFoundation is a hate group who tries to profit by selling overpriced, unproven vitamins as 'miracle cures' for COVID19, AIDS, etc etc etc

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

3cde67  No.257813

File: a4ffd72f47746b2⋯.jpg (157.82 KB, 2160x1080, 2:1, PicsArt_05_01_09_57_01.jpg)

>>257655

>Asked by the CNews interviewer what the goal of these molecular biologists was, Montagnier said it wasn’t clear. “My job,” he said, “is to expose the facts.”

you forgot to mention that he prefaced that statement by saying "IM AGED OUT"

translation = he's over the hill, washed up, out of the loop

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

3cde67  No.257814

>>257655

Dear Dr. Montagnier,

when you obtained the complete genome sequence of SARS-CoV-2, family Coronaviridae, genus Betacoronavirus, by conducting the real-time reverse transcriptase PCR (rRT-PCR) did you use the Illumina MiSeq system with the Burrows-Wheeler Aligner MEM algorithm (BWA-MEM) 0.7.5a-r405 assembly method?

Did you amplify the full genome directly from the RNA extract from the original specimen using gene-specific primers for open reading frame 1b (ORF1b) and N to produce overlapping PCR products covering the full genome ?

Where the expected amplicon sizes of the ORF1b and N gene assays 132 bp and 110 bp, respectively ?

Where the raw reads were first cleaned by trimming low-quality bases with Trimmomatic 0.36 (-phred33, LEADING:20, TRAILING:20, SLIDINGWINDOW:4:20, MINLEN:40) ?

Was the new genome sequence obtained by first mapping reads to a reference SARS-CoV-2 genome using BWA-MEM 0.7.5a-r405 with default parameters to generate the consensus sequence?

Was the assembly produced by MEGAHIT 1.2.9 (de novo assembly), using default parameters, to cross-validate with the reference-based method as an internal control ?

Were the two results consistent, and your final sequence based on the reference-based method?

Was the reference sequence you used from the Global Initiative on Sharing All Influenza Database (GISAID; strain identifier EPI_ISL_405839) ?

Was your resulting sequence curated in a pileup alignment file to obtain the consensus sequence (minimum coverage threshold, 10) with FastQC 0.11.8 used to assess the sequence quality before trimming and after alignment to prevent potential errors ?

Was a total of 9,891,431 records included in your reference-based alignment after trimming, and 9,887,093 (99.96%) of them mapped to the SARS-CoV-2 reference genome?

NO !!! BECAUSE LUC MONTAGNIER HASN'T ACTUALLY DONE ANY HANDS-ON WORK WITH THE VIRUS!!!

he openly admits that he 'and an unnamed friend's have simply looked at a computer, just like you and me….

He has NOT done any actual gene sequencing on SARS-COV-2 whatsoever… none… nothing.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

7693d4  No.257817

>>257747

>Adults

more like sodomy lovers/promoters

>Imaginary

Macro evolution is imaginary nonsense.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

fc4fe9  No.257818

>>257655

PLEASE BE WARNED: EVIL RAID INCOMMING, PLEASE STAY SAFE

PLEASE DON'T LET THIS SUCCEED

EVIDENCE:

https://onee.ch/b/res/11522.html

https://archive.is/7io1G

WARNING, a bunch of very evil hardcore spammer trolls are planning MASSIVE ILLEGAL CP SPAM ATTACKS

AND PROPAGANDA AND DEFAMATION AND SMEAR CAMPAIGNS ON ALL CHAN WEBSITES TO CAUSE CHAOS,

PANIC, AND THE EVENTUAL SHUT DOWN AND DESTRUCTION OF ALL CHAN WEBSITES

PLEASE DO NOT FALL FOR THIS, AND REPORT ANY ILLEGAL ACTIVITY TO THE AUTHORITIES.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

31548a  No.257821

File: ef711368db41821⋯.jpg (44.93 KB, 640x360, 16:9, U_Mad_Bro.jpg)

>>257818

Is the "evil raid" related to Johnny Neptune?

Inquiring minds want to know!

>>>/freedomzine/1993.html

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

46dce7  No.257822

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

a53bc1  No.257826

>>257810

>>257811

Thank you for the heads up asshole, now backing up the English videos from that channel and will mirror them to Bitchute. Because of people like you targeting them, I KNOW THEY MUST BE GOOD ONES!

>>257812

Vitamins boost your immune system, so yes, they are very good for health. To fight off Corona you'll need lots of Vitamin C & Vitamin D, plus around 30mg of Zinc supplement, curcumin to boost the immune system. Make sure you have some acetaminophen available to control really high fevers and some expectorant if you have pneumonia symptoms! Also, take an anti-viral every day (Chaga mushrooms will do fine).

>>257818

I bet, because they are afraid! You can see them literally squirming in fear that no one buys their BS State-run propaganda anymore! No one except a few like Johnny.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

ebb488  No.257827

>>257821

I have been noticing some assholes must be using Tor IPs to post banned content like CP recently and thus half the Tor IPs are blocked on certain boards. Likely feds doing shady shit because they hate us and wish they could control narratives, that's my guess! It's almost always the enemies of free speech who resort to such extremist desperate measures.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

0a1a14  No.257828

Happening is back on the menu boys

Shi Zhengli, the woman who fucked everything up, has fled to the US embassy in France with thousands of documents linking virus to wuhan labs seeking asylum!

https://twitter.com/h_wang_02/status/1256206524575252480?s=20

http://archive.vn/7WFg3

http://archive.vn/wm5oZ

Inb4 she suddenly commits 'suicide' and it's swept under the rug!

WHY would she flee to a US-run Embassy when the NIH was using US taxpayer money to fund the Wuhan bioweapon lab? That's like going to the mafia saying you have dirt on one of their connections! LOL!

Related: >>257825

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

d8f511  No.257832

>>257827

REALITY CHECK :

You're completely insignificant, marginalized and disenfranchised. Nobody gives a flying fuck what you have to say, especially not any government secret agents.

You seem to think you're more important than you really are. Compensation is predictable from people like you.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

6aa7b1  No.257833

>>257832

If nobody gave a fuck about what I said no one would ever reply to me, compliment me for my news archives or associate with me (and I'd just keep posting anyway or find something better to do). But some do seem to care what I have to share, and do have some decent input, and that is what counts! PS: /please report me/ is not exactly where I hang out here anyway! I much prefer /pnd/ now which has mostly turned to shit, except for the survival threads and corona-chan!

And if 8chan wasn't ever a threat, they would have never have been shut down! Nor would spammers be trying to get thousands of Tor IPs blocked here!!

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

b70bc9  No.257836

File: e83a8d7ae977af7⋯.jpg (1.64 MB, 2643x1982, 2643:1982, PicsArt_12_28_12_14_06.jpg)

>>257833

It's no use, Killcen. Johnny is on a mission today, like a mad missionary from AOC hell. He got me to reply all day long too, Killcen-style, as it were; and I'm sure him and Wendy are laughing about what idiots we both are for letting him push our buttons – but methinks someone smells the end of the free ride into slavery and knows that the road to freedom is rocky, scary and uncertain, but right in front of us! The free ride is over.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

7c4e9c  No.257837

>>257836

Has Johnny gotten more political because of Trump lol? I think the same ironically happened to me under Bush and Obama (I hated both those presidents so much, much more-so than any of the previous in my lifetime!) Anyhoot, I'm not angry at Johnny, he just seems like a bootlicking faggot today (reporting innocent people and random health channels WTF!?) It's gotten so pathetic he'd be a good candidate to run for next president of the US lol!

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

6f9ede  No.257855

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

3a8a3b  No.257868

File: 61ac3d68614da00⋯.png (259.88 KB, 576x417, 192:139, man_buscemi_disturbed.png)

>>257655

>Nobel Prize-Winning Scientist Who Discovered HIV Says Coronavirus Was Created In Laboratory

This is amazing! Now, is there a Nobel-winning physicist who can determine whether rocks fall up or down when dropped?

OF COURSE IT WAS FUCKING GROWN IN A LAB! A CHINESE FUCKING LAB!

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

44abab  No.257882

>>257855

Q: are you willing to admit that you don't understand chemistry, biology, virology, or any field of medicine or science whatsoever?

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

44abab  No.257887

>>257828

WHATS HILARIOUS :

You actually take time out of your life archiving those boring worthless trivial insignificant articles

But then again, come to think of it……

it is YOUR 'life', so it's not like you've got anything else to do

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

76ce1f  No.257888

If there were no laboratory's with hardcore knowledge and men tinkering around with this stuff. This virus would have never reached the human system, it had to be tweaked for a human body to accept the type of virus it was. #ShillsGetBent where are all the vaccinators on the HIV vaccines or was that tweaked too? The elites are scared for the real scientist to come out of the wood work and open the real envelope of all the micro biologist that died in random fashions over the last 30years……..

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

76ce1f  No.257889

If there were no laboratory's with hardcore knowledge and men tinkering around with this stuff. This virus would have never reached the human system, it had to be tweaked for a human body to accept the type of virus it was. #ShillsGetBent where are all the vaccinators on the HIV vaccines or was that tweaked too? The elites are scared for the real scientist to come out of the wood work and open the real envelope of all the micro biologist that died in random fashions over the last 30years……..

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

9d75b7  No.257893

>>257888

Hey Johnny, I'm posting this here first, especially for you. I haven't got my next news bomb fully loaded yet, but here is something in it. Read it and weep!

http://archive.md/gOhwX

http://archive.md/ZwEeE

https://www.zerohedge.com/geopolitical/key-findings-leaked-government-dossier-china-bat-virus-program

https://www.dailytelegraph.com.au/coronavirus/bombshell-dossier-lays-out-case-against-chinese-bat-virus-program/news-story/55add857058731c9c71c0e96ad17da60?nk=37f5e39c5bf18de4461ef00366e92bab-1588469191

>>257868

Yep. And the NIH helped fund it under Fauci's direction too, and we all know his ties to Bill Gates Foundation and the rest! The info is out there, it's leaked, it's backed up, it's archived and it's spreading and spreading and there ain't nothing they can do to stop the truth from getting out!!!

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

9d75b7  No.257895

Hahaha! Word is Trump was recently briefed on Fauci's corrupt past and ties to NIH funding! Hahaha! If true, he's a goner!!!

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

9d75b7  No.257898

>>257887

Honestly, I love helping expose the corrupt! And they are being exposed! Peep the new bombshells, they're some good ones!

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

44abab  No.257901

>>257898

And I love exposing YOU as an out of the loop old fool, always the last to know

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

44abab  No.257902

>>257898

And I love exposing YOU as an out of the loop old fool, always the last to know

For example everybody's known about fouch's involvement for a very long time, but you just now discovered it on one of your predictable conspiracy websites

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

44abab  No.257904

And technically, Fauci has worked for the NIAID since 1982

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

31f667  No.257927

>>257895

what's hilarious is that you just admitted that YOUR stupid president has been in office almost 4 years, but he doesn't realize the backgrounds of those he has working for him !!!

Trump doesn't know the difference between the NIH and the NIAID

obviously, neither do YOU

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

31f667  No.257928

>>257655

when you obtained the complete genome sequence of SARS-CoV-2, family Coronaviridae, genus Betacoronavirus, by conducting the real-time reverse transcriptase PCR (rRT-PCR) did you use the Illumina MiSeq system with the Burrows-Wheeler Aligner MEM algorithm (BWA-MEM) 0.7.5a-r405 assembly method?

Did you amplify the full genome directly from the RNA extract from the original specimen using gene-specific primers for open reading frame 1b (ORF1b) and N to produce overlapping PCR products covering the full genome ?

Where the expected amplicon sizes of the ORF1b and N gene assays 132 bp and 110 bp, respectively ?

Where the raw reads were first cleaned by trimming low-quality bases with Trimmomatic 0.36 (-phred33, LEADING:20, TRAILING:20, SLIDINGWINDOW:4:20, MINLEN:40) ?

Was the new genome sequence obtained by first mapping reads to a reference SARS-CoV-2 genome using BWA-MEM 0.7.5a-r405 with default parameters to generate the consensus sequence?

Was the assembly produced by MEGAHIT 1.2.9 (de novo assembly), using default parameters, to cross-validate with the reference-based method as an internal control ?

Were the two results consistent, and your final sequence based on the reference-based method?

Was the reference sequence you used from the Global Initiative on Sharing All Influenza Database (GISAID; strain identifier EPI_ISL_405839) ?

Was your resulting sequence curated in a pileup alignment file to obtain the consensus sequence (minimum coverage threshold, 10) with FastQC 0.11.8 used to assess the sequence quality before trimming and after alignment to prevent potential errors ?

Was a total of 9,891,431 records included in your reference-based alignment after trimming, and 9,887,093 (99.96%) of them mapped to the SARS-CoV-2 reference genome?

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

31f667  No.257929

>>257655

unfortunately, if you failed to follow ANY of that exacting protocol, then your results mean nothing.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

7e01a1  No.257931

You're all missing the point. Why is there a need for an AIDS vaccine? It's called a condom, or fidelity, or not taking drugs, or not being a faggot, or fucking monkeys. Aside from the very few AIDS victims who have caught it in the womb or from transfusions, most people catch it because of degeneracy. It's the original sin eater.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

b99906  No.257933

>>257902

>For example everybody's known about fouch's involvement for a very long time

And you still trust those corrupt sacks of shit while denying everything the media has exposed, claiming you suddenly knew this the whole time? Something doesn't add up here.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

b99906  No.257934

>>257928

Somehow I doubt you know what that means either, but let's be fair and admit what has been exposed already: it's a fucking bioweapon, it originated from the Wuhan lab, the lab used US taxpayer money from the NIH and Bill Gates and Dr. Fauci are co-conspirators as they have their dirty fingerprints all over the funding and vaccine planning for this exact type of bioweapon and even predicted it in their plans before the outbreak. You can try denying it all you want but it does you no good at this point. This is now well known and talked about now days. The cat is out of the bag now. Period. Admit it, or continue your damage control but it won't work.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

cd8856  No.257936

>>257929

Before I get off to my new part time job helping a friend with landscaping, I'll just copy pasta what I told someone else on /pnd/!

The effects vary from person to person as there are thousands, if not hundreds of thousands, of mutations by now all over the globe. Some are worse than others, but it also depends how strong or weak individual immune systems are of the victims. If you get a less deadly strain of this bioweapon mutation and have a healthy immune system you can survive it with relatively low damage done. If you catch a much more deadly strain, you might not end up so lucky! Then factor in those who don't have healthy immune systems, who are malnourished or have pre-existing conditions….. it's a very thorny topic because we are not dealing with one particular virus as it rapidly mutates and has other viral RNA sequences injected into it, making it possible for various degrees of strain.

Right now, there could be 50% of the world population that has it, but only a fraction of that have symptoms that show up. Why? Rapid mutations and the fact not all of them are all that severe.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

52c2b0  No.257939

the guy using the bold and gaslighting everyone ruined the thread and anyone of real interest or concern has to dig through his lot of dogshit posts hiding them

if you open links and read you can clearly see the evidence is there

too many coincidences, doesnt mean is 100% infallible nothing is

but the scale is tipping base over in that theorys favor

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

44abab  No.257940

>>257934

>>257936

OBVIOUSLY, I KNOW WHAT ALL OF IT MEANS….

IVE BEEN RESEARCHING IT……

YOU NEVER RESEARCH JACK SHIT!!!!!

YOU JUST COPY N PASTE COPY N PASTE

BUT YOU NEVER EDUCATE YOURSELF

THE PROTOCOL I LISTED IS EXACTLY WHAT LUC MONTAGNIER DID NOT DO WHEN HE SAT ON HIS ASS AND MADE FAR FETCHED CLAIMS ,!!!

HIV, MY ASS !!!!!

P R O V E I T ! ! ! !

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

44abab  No.257942

>>257939

RE: open the links

NOBODY READS YOUR LINKS

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

5b59aa  No.257947

DEAR KILLCEN : if you raised a child from birth, without ever exposing the child to religion, the child would become an adult, and never have a concept of 'demons'

if you raised 10 children from birth, without ever exposing the children to religion, the children would become adults, and never have a concept of 'demons'

if you raised 100 children from birth, without ever exposing the children to religion, the children would become adults, and never have a concept of 'demons'

if you raised 1,000 children from birth, without ever exposing the children to religion, the children would become adults, and never have a concept of 'demons'

if you raised 10,000 children from birth, without ever exposing the children to religion, the children would become adults, and never have a concept of 'demons'

if you raised 100,000 children from birth, without ever exposing the children to religion, the children would become adults, and never have a concept of 'demons'

if you raised 1,000,000 children from birth, without ever exposing the children to religion, the children would become adults, and never have a concept of 'demons'

if you raised 1,000,000,000 children from birth, without ever exposing the children to religion, the children would become adults, and never have a concept of 'demons'

if you raised 1,000,000,000,000 children from birth, without ever exposing the children to religion, the children would become adults, and never have a concept of 'demons'

if you raised 100,000,000,000,000,000,000,000,000,000,000 children from birth, without ever exposing the children to religion, the children would become adults, and never have a concept of 'demons'

because 'demons' aren't real

it's all in your head, like the voices

and your religion proves that you are predisposed to believing in imaginary nonsense

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

02eb11  No.257948

File: 2ee13160ab2cc69⋯.jpg (76.3 KB, 616x646, 308:323, revelationbeast.jpg)

>>257893

>it's archived and it's spreading and spreading and there ain't nothing they can do to stop the truth from getting out!!!

The truth always gets out, sooner or later. The problem is the elites no longer care because they have all their safeguards in place. We're coming to the final showdown relatively soon.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

02eb11  No.257949

>>257947

>because 'demons' aren't real

You'll find out.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

5b59aa  No.257950

>>257948

shut up, boring old fool.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

5b59aa  No.257951

>>257948

shut up, boring old fool. You never 'inform' or 'educate' anybody, because you're uninformed and uneducated

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

377d85  No.257954

YouTube embed. Click thumbnail to play.

>>257948

shut up, boring old fool. You never 'inform' or 'educate' anybody, because you're uninformed and uneducated

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

377d85  No.257956

>>257948

……says the ADMITTED SCHIZOPHRENIC

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

377d85  No.257958

YouTube embed. Click thumbnail to play.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

377d85  No.257959

YouTube embed. Click thumbnail to play.

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

377d85  No.257960

YouTube embed. Click thumbnail to play.
Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

8ffed9  No.257963

>>257666

Checked

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

799abd  No.257980

>>257956

Your talking to the wrong person! And again, as I said before, I do NOT have full blown schizophrenia, just schizophrenic withdrawal symptoms if I don't drink for a couple weeks straight (quitting cold turkey). That's actually more normal than you might think! Question: do kikes like you get into witchcraft and cast spells against your political enemies? Reason I must ask is I get the vibe you kind of people like to target others in demonic supernatural ways, which would make sense many others feel a heightened demonic presence today!

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

f36a95  No.257982

>>257980

Did one of the demonic voices in your head tell you that?

I'm done here

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

f36a95  No.257983

Two Questions for killcen:

1 : did you vote for Trump?

2 : goodbye forever

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

b35d61  No.257986

>>257983

I did vote for Trump, mostly because I hate Hillary Clinton (and I don't give a SHIT if Bill was a pervert, I have no beef with Bill - it's Hillary I fucking despise!) That said, I think Trump has a huge ego problem and is a fool. BUT….. he's not out to kill us or destroy America….. and that is why I'd rather have him than the crooked nutty Anti-American corrupt shit stains running the third world DNC circus freak show.

My opinion, yes Trump may suck…. but it could be a HELL OF A LOT WORSE.

By the way, sorry if I offended you Johnny. I didn't mean to. You are a good person, deep down, a bit disturbed but good none-the-less. I hope the best for You and Wendy!

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

f09b6a  No.258056

Trump vote = game changer

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

f09b6a  No.258057

8K UNworthy

8K UNinformative

8K UNmerchandise

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

f09b6a  No.258058

File: 5d2d7bdc0f4766c⋯.jpg (104.71 KB, 1003x1318, 1003:1318, 56600966_10157239644334637….jpg)

Heres my doctor, believe it or not

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.

f09b6a  No.258059

File: 3f8961308e70220⋯.jpg (81.47 KB, 720x960, 3:4, 56502777_10157239644324637….jpg)

He's THE BEST DOCTOR ive ever met

Disclaimer: this post and the subject matter and contents thereof - text, media, or otherwise - do not necessarily reflect the views of the 8kun administration.



[Return][Go to top][Catalog][Nerve Center][Post a Reply]
[]
[ / / / / / / / / / / / / / ] [ dir / cow / cyoa / k / kind / mu / s / shousa / tech ]